General Information of the Ferroptosis Regulator (ID: REG10184)
Regulator Name Thymosin beta-4 (TMSB4X)
Synonyms
TB4X, THYB4, TMSB4; Fx
    Click to Show/Hide
Gene Name TMSB4X
Gene ID 7114
Regulator Type Protein coding
Uniprot ID P62328
Sequence
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

    Click to Show/Hide
Family Thymosin beta family
Function
Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.

    Click to Show/Hide
HGNC ID
HGNC:11881
KEGG ID hsa:7114
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TMSB4X can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Nonalcoholic fatty liver disease ICD-11: DB92
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
The 42 Specified Pathogen Free (SPF)-grade Sprague Dawley (SD) male rats with weighing (180 ± 20) g were purchased from Changsha Tianqin Experimental Animal Center. All rat were randomly divided into seven groups (6 rat per group) using a random number table. Rats were deeply anesthetized with chloral hydrate (0.5 ml/kg) and killed at the end of the experiment, after 8 weeks of modeling and 4 weeks of drug treatment.

    Click to Show/Hide
Response regulation T4 ( TMSB4X and TMSB4Y) protects hepatocytes by inhibiting the GPX4-mediated ferroptosis pathway, which provides a new strategy and target for the treatment of non-alcoholic fatty liver disease (NAFLD).
Nonalcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Thymosin beta-4 (TMSB4X) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
The 42 Specified Pathogen Free (SPF)-grade Sprague Dawley (SD) male rats with weighing (180 ± 20) g were purchased from Changsha Tianqin Experimental Animal Center. All rat were randomly divided into seven groups (6 rat per group) using a random number table. Rats were deeply anesthetized with chloral hydrate (0.5 ml/kg) and killed at the end of the experiment, after 8 weeks of modeling and 4 weeks of drug treatment.

    Click to Show/Hide
Response regulation T4 ( TMSB4X and TMSB4Y) protects hepatocytes by inhibiting the GPX4-mediated ferroptosis pathway, which provides a new strategy and target for the treatment of non-alcoholic fatty liver disease (NAFLD).
References
Ref 1 Thymosin beta 4 alleviates non-alcoholic fatty liver by inhibiting ferroptosis via up-regulation of GPX4. Eur J Pharmacol. 2021 Oct 5;908:174351. doi: 10.1016/j.ejphar.2021.174351. Epub 2021 Jul 16.