Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10177)
Regulator Name BH3-interacting domain death agonist (BID)
Synonyms
p22 BID
    Click to Show/Hide
Gene Name BID
Gene ID 637
Regulator Type Protein coding
Uniprot ID P55957
Sequence
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD

    Click to Show/Hide
Function
Induces caspases and apoptosis. Counters the protective effect of BCL2.

    Click to Show/Hide
HGNC ID
HGNC:1050
KEGG ID hsa:637
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
BID can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatoblastoma ICD-11: DB91
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
Response regulation Quercetin induced EB-mediated lysosome activation and increased ferritin degradation leading to ferroptosis and Bid-involved apoptosis in hepatoblastoma cells.
Hepatoblastoma [ICD-11: DB91]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator BH3-interacting domain death agonist (BID) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
Response regulation Quercetin induced EB-mediated lysosome activation and increased ferritin degradation leading to ferroptosis and Bid-involved apoptosis in hepatoblastoma cells.
References
Ref 1 Quercetin induces p53-independent cancer cell death through lysosome activation by the transcription factor EB and Reactive Oxygen Species-dependent ferroptosis. Br J Pharmacol. 2021 Mar;178(5):1133-1148. doi: 10.1111/bph.15350. Epub 2021 Feb 2.