Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10157)
Regulator Name ETS translocation variant 4 (ETV4)
Synonyms
E1AF, PEA3; Adenovirus E1A enhancer-binding protein; E1A-F; Polyomavirus enhancer activator 3 homolog
    Click to Show/Hide
Gene Name ETV4
Gene ID 2118
Regulator Type Protein coding
Uniprot ID P43268
Sequence
MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHF
QETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHH
GEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGE
HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQP
AVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFI
AWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKG
GYSY

    Click to Show/Hide
Family ETS family
Function
Transcriptional activator. May play a role in keratinocyte differentiation.

    Click to Show/Hide
HGNC ID
HGNC:3493
KEGG ID hsa:2118
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ETV4 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Thyroid cancer ICD-11: 2D10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell cycle
In Vitro Model
 TPC-1 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
IHH-4 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_2960
Nthy-ori3-1 cells Normal Homo sapiens CVCL_2659
In Vivo Model
Six-week-old BALB/c female nude mice (HFK Bioscience, Beijing, China) were used to perform experimentsin vivo. One hundred forty-four mice were randomly divided into four groups (36 mice in each group). TPC-1 cells were stably transfected with NC shRNA or ETV4-shRNA, and GLAG-66 cells were stably transfected with ETV4-OE or Vector. 5 x 106 cells were injected subcutaneously into the right armpit in mice. After 7 days, the diameter of tumors was measured every 3 days to calculate the tumor volume.

    Click to Show/Hide
Response regulation The downregulation of ETV4 repressed the tumor development through the low expression of SLC7A11, and the ETV4 overexpression obtained the contrary effects. Overall, knockdown of ETV4 suppressed the papillary thyroid cancer progression by promoting ferroptosis upon SLC7A11 downregulation.
Thyroid cancer [ICD-11: 2D10]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator ETS translocation variant 4 (ETV4) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell cycle
In Vitro Model
 TPC-1 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
IHH-4 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_2960
Nthy-ori3-1 cells Normal Homo sapiens CVCL_2659
In Vivo Model
Six-week-old BALB/c female nude mice (HFK Bioscience, Beijing, China) were used to perform experimentsin vivo. One hundred forty-four mice were randomly divided into four groups (36 mice in each group). TPC-1 cells were stably transfected with NC shRNA or ETV4-shRNA, and GLAG-66 cells were stably transfected with ETV4-OE or Vector. 5 x 106 cells were injected subcutaneously into the right armpit in mice. After 7 days, the diameter of tumors was measured every 3 days to calculate the tumor volume.

    Click to Show/Hide
Response regulation The downregulation of ETV4 repressed the tumor development through the low expression of SLC7A11, and the ETV4 overexpression obtained the contrary effects. Overall, knockdown of ETV4 suppressed the papillary thyroid cancer progression by promoting ferroptosis upon SLC7A11 downregulation.
References
Ref 1 The Knockdown of ETV4 Inhibits the Papillary Thyroid Cancer Development by Promoting Ferroptosis Upon SLC7A11 Downregulation. DNA Cell Biol. 2021 Sep;40(9):1211-1221. doi: 10.1089/dna.2021.0216. Epub 2021 Jul 19.