Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10149)
Regulator Name Cyclin-dependent kinase inhibitor 1 (CDKN1A)
Synonyms
CAP20, CDKN1, CIP1, MDA6, PIC1, SDI1, WAF1; CDK-interacting protein 1; Melanoma differentiation-associated protein 6; p21
    Click to Show/Hide
Gene Name CDKN1A
Gene ID 1026
Regulator Type Protein coding
Uniprot ID P38936
Sequence
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP

    Click to Show/Hide
Family CDI family
Function
May be involved in p53/TP53 mediated inhibition of cellular proliferation in response to DNA damage. Binds to and inhibits cyclin- dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D- CDK4 complex. Inhibits DNA synthesis by DNA polymerase delta by competing with POLD3 for PCNA binding. Plays an important role in controlling cell cycle progression and DNA damage- induced G2 arrest.

    Click to Show/Hide
HGNC ID
HGNC:1784
KEGG ID hsa:1026
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CDKN1A can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Colon cancer ICD-11: 2B90
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
HeLa cells Endocervical adenocarcinoma Homo sapiens CVCL_0030
HEK-293T cells Normal Homo sapiens CVCL_0063
HIEC-6 cells Normal Homo sapiens CVCL_6C21
Response regulation RRM1 increases the instability of p53 by regulating the physical interaction of p53 with the ubiquitinating enzyme MDM2 and the deubiquitinating enzyme USP11, subsequently suppressing p21 (CDKN1A) and GPX4, thereby promoting the accumulation of lipid peroxidation and occurrence of radiation-induced ferroptosis in Colon carcinoma.
Colon cancer [ICD-11: 2B90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Cyclin-dependent kinase inhibitor 1 (CDKN1A) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
HeLa cells Endocervical adenocarcinoma Homo sapiens CVCL_0030
HEK-293T cells Normal Homo sapiens CVCL_0063
HIEC-6 cells Normal Homo sapiens CVCL_6C21
Response regulation RRM1 increases the instability of p53 by regulating the physical interaction of p53 with the ubiquitinating enzyme MDM2 and the deubiquitinating enzyme USP11, subsequently suppressing p21 (CDKN1A) and GPX4, thereby promoting the accumulation of lipid peroxidation and occurrence of radiation-induced ferroptosis in Colon carcinoma.
References
Ref 1 Knockdown of RRM1 in tumor cells promotes radio-/chemotherapy induced ferroptosis by regulating p53 ubiquitination and p21-GPX4 signaling axis. Cell Death Discov. 2022 Aug 1;8(1):343. doi: 10.1038/s41420-022-01140-z.