General Information of the Ferroptosis Regulator (ID: REG10142)
Regulator Name Activin receptor type-1B (ACVR1B)
Synonyms
ACVRLK4, ALK4; Activin receptor type IB; Activin receptor-like kinase 4; Serine/threonine-protein kinase receptor R2
    Click to Show/Hide
Gene Name ACVR1B
Gene ID 91
Regulator Type Protein coding
Uniprot ID P36896
Sequence
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI

    Click to Show/Hide
Family TKL Ser/Thr protein kinase family
Function
Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine- threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type- 1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2.

    Click to Show/Hide
HGNC ID
HGNC:172
KEGG ID hsa:91
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ACVR1B can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Health ICD-11: N.A.
Pathway Response Ferroptosis hsa04216
Apoptosis hsa04210
Necroptosis hsa04217
Cell Process Cell ferroptosis
Cell apoptosis
Cell necrosis
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
Response regulation The activin receptor-like kinase (ALK) 4/5 ( ACVR1B/TGFBR1), also known as activin-transforming growth factor (TGF) receptor, is involved in stress-induced renal injury. Pharmacological inhibition of ALK4/5 signaling attenuated erastin-induced ferroptosis by hyperactivating Nrf2 signaling in HK-2 cells.
Health [ICD-11: N.A.]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Activin receptor type-1B (ACVR1B) Protein coding
Pathway Response Ferroptosis hsa04216
Apoptosis hsa04210
Necroptosis hsa04217
Cell Process Cell ferroptosis
Cell apoptosis
Cell necrosis
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
Response regulation The activin receptor-like kinase (ALK) 4/5 ( ACVR1B/TGFBR1), also known as activin-transforming growth factor (TGF) receptor, is involved in stress-induced renal injury. Pharmacological inhibition of ALK4/5 signaling attenuated erastin-induced ferroptosis by hyperactivating Nrf2 signaling in HK-2 cells.
References
Ref 1 Blockade of ALK4/5 signaling suppresses cadmium- and erastin-induced cell death in renal proximal tubular epithelial cells via distinct signaling mechanisms. Cell Death Differ. 2019 Nov;26(11):2371-2385. doi: 10.1038/s41418-019-0307-8. Epub 2019 Feb 25.