Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10096)
Regulator Name Metallothionein-1G (MT1G)
Synonyms
MT1K, MT1M; Metallothionein-1K; Metallothionein-IG
    Click to Show/Hide
Gene Name MT1G
Gene ID 4495
Regulator Type Protein coding
Uniprot ID P13640
Sequence
MDPNCSCAAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSC
CA

    Click to Show/Hide
Family Metallothionein superfamily
Function
Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

    Click to Show/Hide
HGNC ID
HGNC:7399
KEGG ID hsa:4495
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MT1G can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 3 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HCT-8 cells Ileocecal adenocarcinoma Homo sapiens CVCL_2478
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
NCM460 cells Normal Homo sapiens CVCL_0460
Response regulation The downregulated ferroptosis-associated gene MT1G and revealed that a low MT1G level displayed a worse prognosis in colorectal cancer patients. In addition, the MT1G expression was closely related to the immune microenvironment and involved in the progression of tumors.
Experiment 2 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
In Vivo Model
To generate murine subcutaneous tumors, 2 x 106 Huh7 cells in control shRNA or MT-1G knockdown cells in 200 ul phosphate buffered saline were injected subcutaneously to the right of the dorsal midline in nude mice. Once the tumors reached 80-100 mm3 at day seven, mice were randomly allocated into groups and treated with sorafenib (10 mg/kg/intraperitoneal injection (i.p.), once every other day) for two weeks. In another experiment, nude mice were injected subcutaneously with indicated Huh7 cells (2 x 106 cells/mouse) and treated with sorafenib (10 mg/kg/i.p., once every other day) with or without ATRA (0.5 mg/kg/i.p., once every other day) or PPG (10 mg/kg/i.p., once every other day) at day seven for two weeks.

    Click to Show/Hide
Response regulation MT-1G is a critical regulator and promising therapeutic target of sorafenib resistance in human hepatocellular carcinoma cells. Knockdown of MT-1G by RNA interference increases glutathione depletion and lipid peroxidation, which contributes to sorafenib-induced ferroptosis.
Experiment 3 Reporting the Ferroptosis Target of This Regulator [3]
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 769-P cells Renal cell carcinom Homo sapiens CVCL_1050
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Response regulation MT1G affects ferroptosis by regulating GSH consumption in clear cell renal cell carcinoma (ccRCC) cells. MT1G may be a negative regulator of ferroptosis in ccRCC cells and a biomarker of poor prognosis.
Colorectal cancer [ICD-11: 2B91]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Metallothionein-1G (MT1G) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HCT-8 cells Ileocecal adenocarcinoma Homo sapiens CVCL_2478
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
NCM460 cells Normal Homo sapiens CVCL_0460
Response regulation The downregulated ferroptosis-associated gene MT1G and revealed that a low MT1G level displayed a worse prognosis in colorectal cancer patients. In addition, the MT1G expression was closely related to the immune microenvironment and involved in the progression of tumors.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Metallothionein-1G (MT1G) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
In Vivo Model
To generate murine subcutaneous tumors, 2 x 106 Huh7 cells in control shRNA or MT-1G knockdown cells in 200 ul phosphate buffered saline were injected subcutaneously to the right of the dorsal midline in nude mice. Once the tumors reached 80-100 mm3 at day seven, mice were randomly allocated into groups and treated with sorafenib (10 mg/kg/intraperitoneal injection (i.p.), once every other day) for two weeks. In another experiment, nude mice were injected subcutaneously with indicated Huh7 cells (2 x 106 cells/mouse) and treated with sorafenib (10 mg/kg/i.p., once every other day) with or without ATRA (0.5 mg/kg/i.p., once every other day) or PPG (10 mg/kg/i.p., once every other day) at day seven for two weeks.

    Click to Show/Hide
Response regulation MT-1G is a critical regulator and promising therapeutic target of sorafenib resistance in human hepatocellular carcinoma cells. Knockdown of MT-1G by RNA interference increases glutathione depletion and lipid peroxidation, which contributes to sorafenib-induced ferroptosis.
Hereditary Leiomyomatosis [ICD-11: 2C90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [3]
Target Regulator Metallothionein-1G (MT1G) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 769-P cells Renal cell carcinom Homo sapiens CVCL_1050
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Response regulation MT1G affects ferroptosis by regulating GSH consumption in clear cell renal cell carcinoma (ccRCC) cells. MT1G may be a negative regulator of ferroptosis in ccRCC cells and a biomarker of poor prognosis.
References
Ref 1 Ferroptosis-Related Gene MT1G as a Novel Biomarker Correlated With Prognosis and Immune Infiltration in Colorectal Cancer. Front Cell Dev Biol. 2022 Apr 20;10:881447. doi: 10.3389/fcell.2022.881447. eCollection 2022.
Ref 2 Metallothionein-1G facilitates sorafenib resistance through inhibition of ferroptosis. Hepatology. 2016 Aug;64(2):488-500. doi: 10.1002/hep.28574. Epub 2016 May 24.
Ref 3 Upregulation of Metallothionein 1G (MT1G) Negatively Regulates Ferroptosis in Clear Cell Renal Cell Carcinoma by Reducing Glutathione Consumption. J Oncol. 2022 Sep 27;2022:4000617. doi: 10.1155/2022/4000617. eCollection 2022.