Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10070)
Regulator Name N-myc proto-oncogene protein (MYCN)
Synonyms
BHLHE37, NMYC; Class E basic helix-loop-helix protein 37
    Click to Show/Hide
Gene Name MYCN
Gene ID 4613
Regulator Type Protein coding
Uniprot ID P04198
Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPP
LSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGF
SAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELA
HPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPG
GRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLK
SVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC

    Click to Show/Hide
Function
Positively regulates the transcription of MYCNOS in neuroblastoma cells.

    Click to Show/Hide
HGNC ID
HGNC:7559
KEGG ID hsa:4613
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MYCN can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Transferrin receptor protein 1 (TFRC) [Driver; Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor/Driver
Responsed Disease Neuroblastoma ICD-11: 2D50
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SH-EP cells Neuroblastoma Homo sapiens CVCL_0524
SK-N-AS cells Neuroblastoma Homo sapiens CVCL_1700
SH-SY5Y cells Neuroblastoma Homo sapiens CVCL_0019
Response regulation Pediatric neuroblastoma (NB) cells harboring MYCN amplification are prone to undergo ferroptosis conferred by TFRC upregulation, suggesting that GPX4-targeting ferroptosis inducers or TFRC agonists can be potential strategies in treating MYCN-amplified NB.
Neuroblastoma [ICD-11: 2D50]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator N-myc proto-oncogene protein (MYCN) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SH-EP cells Neuroblastoma Homo sapiens CVCL_0524
SK-N-AS cells Neuroblastoma Homo sapiens CVCL_1700
SH-SY5Y cells Neuroblastoma Homo sapiens CVCL_0019
Response regulation Pediatric neuroblastoma (NB) cells harboring MYCN amplification are prone to undergo ferroptosis conferred by TFRC upregulation, suggesting that GPX4-targeting ferroptosis inducers or TFRC agonists can be potential strategies in treating MYCN-amplified NB.
References
Ref 1 MYCN mediates TFRC-dependent ferroptosis and reveals vulnerabilities in neuroblastoma. Cell Death Dis. 2021 May 19;12(6):511. doi: 10.1038/s41419-021-03790-w.