General Information of the Ferroptosis Regulator (ID: REG10063)
Regulator Name Interferon alpha-7 (IFNA7)
Synonyms
Interferon alpha-J; Interferon alpha-J1
    Click to Show/Hide
Gene Name IFNA7
Gene ID 3444
Regulator Type Protein coding
Uniprot ID P01567
Sequence
MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFR
FPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTN
LKKGLRRKD

    Click to Show/Hide
Family Alpha/beta interferon family
Function
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

    Click to Show/Hide
HGNC ID
HGNC:5428
KEGG ID hsa:3444
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
IFNA7 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Systemic lupus erythematosus ICD-11: 4A40
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
hPBMCs (Human peripheral blood mononuclear cells)
In Vivo Model
In ferroptosis rescue experiments, LPX-1 (10 mg/kg), CTX (20 mg/kg) or 0.1 ml DMSO (10%) was administered intraperitoneally to female MRL/Mpj and MRL/lpr mice every other day for six weeks beginning at 12 weeks of age. Urine was collected in the morning once a week. Mice were sacrificed at 18 weeks of age, and spleen, kidneys, lymph nodes, and peripheral blood were collected for analysis. For in vivo treatment, MRL/lprmice were administered 0.1 ml DMSO (10%), Cl-amidine (20 mg/kg), LPX-1 (10 mg/kg), or Cl-amidine (20 mg/kg) combined with LPX-1 (10 mg/kg) intraperitoneally every other day for 3 weeks starting at 12 weeks of age.

    Click to Show/Hide
Response regulation IFN- (IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17, IFNA21) and SLE IgG suppresses the transcription of GPX4 by promoting binding of CREM to the Gpx4 promoter. Together, neutrophil ferroptosis is an important driver of neutropenia in systemic lupus erythematosus (SLE) and heavily contributes to disease manifestations.
Systemic lupus erythematosus [ICD-11: 4A40]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Interferon alpha-7 (IFNA7) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
hPBMCs (Human peripheral blood mononuclear cells)
In Vivo Model
In ferroptosis rescue experiments, LPX-1 (10 mg/kg), CTX (20 mg/kg) or 0.1 ml DMSO (10%) was administered intraperitoneally to female MRL/Mpj and MRL/lpr mice every other day for six weeks beginning at 12 weeks of age. Urine was collected in the morning once a week. Mice were sacrificed at 18 weeks of age, and spleen, kidneys, lymph nodes, and peripheral blood were collected for analysis. For in vivo treatment, MRL/lprmice were administered 0.1 ml DMSO (10%), Cl-amidine (20 mg/kg), LPX-1 (10 mg/kg), or Cl-amidine (20 mg/kg) combined with LPX-1 (10 mg/kg) intraperitoneally every other day for 3 weeks starting at 12 weeks of age.

    Click to Show/Hide
Response regulation IFN- (IFNA1, IFNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, IFNA14, IFNA16, IFNA17, IFNA21) and SLE IgG suppresses the transcription of GPX4 by promoting binding of CREM to the Gpx4 promoter. Together, neutrophil ferroptosis is an important driver of neutropenia in systemic lupus erythematosus (SLE) and heavily contributes to disease manifestations.
References
Ref 1 Glutathione peroxidase 4-regulated neutrophil ferroptosis induces systemic autoimmunity. Nat Immunol. 2021 Sep;22(9):1107-1117. doi: 10.1038/s41590-021-00993-3. Epub 2021 Aug 12.