Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10059)
Regulator Name Transforming growth factor beta-1 proprotein (TGFB1)
Synonyms
TGFB
    Click to Show/Hide
Gene Name TGFB1
Gene ID 7040
Regulator Type Protein coding
Uniprot ID P01137
Sequence
MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

    Click to Show/Hide
Family TGF-beta family
Function
Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively.

    Click to Show/Hide
HGNC ID
HGNC:11766
KEGG ID hsa:7040
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TGFB1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 PLC/PRF/5 cells Hepatocellular carcinoma Homo sapiens CVCL_0485
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
SNU-387 cells Hepatocellular carcinoma Homo sapiens CVCL_0250
SNU-449 cells Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SNU475 cells Hepatocellular carcinoma Homo sapiens CVCL_0497
SK-HEP-1 cells Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
HuH-6 cells Hepatoblastoma Homo sapiens CVCL_4381
Response regulation TGF-B1 represses xCT (SLC7A11) expression via Smad3 activation and enhances lipid peroxidation in hepatocellular carcinoma cells with an early TGF-B1 signature, which would benefit from the targeting of GPX4.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Transforming growth factor beta-1 proprotein (TGFB1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 PLC/PRF/5 cells Hepatocellular carcinoma Homo sapiens CVCL_0485
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
SNU-387 cells Hepatocellular carcinoma Homo sapiens CVCL_0250
SNU-449 cells Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SNU475 cells Hepatocellular carcinoma Homo sapiens CVCL_0497
SK-HEP-1 cells Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
HuH-6 cells Hepatoblastoma Homo sapiens CVCL_4381
Response regulation TGF-B1 represses xCT (SLC7A11) expression via Smad3 activation and enhances lipid peroxidation in hepatocellular carcinoma cells with an early TGF-B1 signature, which would benefit from the targeting of GPX4.
References
Ref 1 TGF-1-mediated repression of SLC7A11 drives vulnerability to GPX4 inhibition in hepatocellular carcinoma cells. Cell Death Dis. 2020 May 29;11(5):406. doi: 10.1038/s41419-020-2618-6.