General Information of the Ferroptosis Regulator (ID: REG10058)
Regulator Name GTPase KRas (KRAS)
Synonyms
KRAS2, RASK2; K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras
    Click to Show/Hide
Gene Name KRAS
Gene ID 3845
Regulator Type Protein coding
Uniprot ID P01116
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM

    Click to Show/Hide
Family Ras family
Function
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner.

    Click to Show/Hide
HGNC ID
HGNC:6407
KEGG ID hsa:3845
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
KRAS can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 2 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Lung cancer ICD-11: 2C25
Responsed Drug Tetraarsenic tetrasulfide Investigative
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
MAPK signaling pathway hsa04010
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
NCI-H23 cells Lung adenocarcinoma Homo sapiens CVCL_1547
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
Response regulation Realgar-induced ferroptosis may be mediated via KRAS/Raf/MAPK. Realgar may be targeted to regulate Raf kinase, thereby further regulating the downstream JNK/ERK signaling cascade to suppress KRAS cells and exert an anticancer activity. In conclusion, realgar may induce ferroptosis by regulating the Raf, and hence plays a role in antiKRAS mutant lung cancer.
Experiment 2 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Rhabdomyosarcoma ICD-11: 2B55
Pathway Response Ferroptosis hsa04216
MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
RMS13 cells Rhabdomyosarcoma Mus musculus CVCL_S112
Response regulation Oncogenic RAS (HRAS, NRAS, KRAS) selectively modulates cell death pathways triggered by cytotoxic stimuli in rhabdomyosarcoma RMS13 cells. In conclusion, our discovery of an increased resistance to oxidative stress imposed by oncogenic RAS mutants in RMS13 cells has important implications for the development of targeted therapies for rhabdomyosarcoma (RMS).
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator GTPase KRas (KRAS) Protein coding
Responsed Drug Tetraarsenic tetrasulfide Investigative
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
MAPK signaling pathway hsa04010
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
NCI-H23 cells Lung adenocarcinoma Homo sapiens CVCL_1547
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
Response regulation Realgar-induced ferroptosis may be mediated via KRAS/Raf/MAPK. Realgar may be targeted to regulate Raf kinase, thereby further regulating the downstream JNK/ERK signaling cascade to suppress KRAS cells and exert an anticancer activity. In conclusion, realgar may induce ferroptosis by regulating the Raf, and hence plays a role in antiKRAS mutant lung cancer.
Rhabdomyosarcoma [ICD-11: 2B55]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator GTPase KRas (KRAS) Protein coding
Pathway Response Ferroptosis hsa04216
MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
RMS13 cells Rhabdomyosarcoma Mus musculus CVCL_S112
Response regulation Oncogenic RAS (HRAS, NRAS, KRAS) selectively modulates cell death pathways triggered by cytotoxic stimuli in rhabdomyosarcoma RMS13 cells. In conclusion, our discovery of an increased resistance to oxidative stress imposed by oncogenic RAS mutants in RMS13 cells has important implications for the development of targeted therapies for rhabdomyosarcoma (RMS).
Tetraarsenic tetrasulfide [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Lung cancer ICD-11: 2C25
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
MAPK signaling pathway hsa04010
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
NCI-H23 cells Lung adenocarcinoma Homo sapiens CVCL_1547
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
Response regulation Realgar-induced ferroptosis may be mediated via KRAS/Raf/MAPK. Realgar may be targeted to regulate Raf kinase, thereby further regulating the downstream JNK/ERK signaling cascade to suppress KRAS cells and exert an anticancer activity. In conclusion, realgar may induce ferroptosis by regulating the Raf, and hence plays a role in antiKRAS mutant lung cancer.
References
Ref 1 Realgarinduced KRAS mutation lung cancer cell death via KRAS/Raf/MAPK mediates ferroptosis. Int J Oncol. 2022 Dec;61(6):157. doi: 10.3892/ijo.2022.5447. Epub 2022 Nov 2.
Ref 2 Oncogenic RAS Mutants Confer Resistance of RMS13 Rhabdomyosarcoma Cells to Oxidative Stress-Induced Ferroptotic Cell Death. Front Oncol. 2015 Jun 22;5:131. doi: 10.3389/fonc.2015.00131. eCollection 2015.