General Information of the Ferroptosis Regulator (ID: REG10056)
Regulator Name GTPase NRas (NRAS)
Synonyms
HRAS1; Transforming protein N-Ras
    Click to Show/Hide
Gene Name NRAS
Gene ID 4893
Regulator Type Protein coding
Uniprot ID P01111
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM

    Click to Show/Hide
Family Ras family
Function
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.

    Click to Show/Hide
HGNC ID
HGNC:7989
KEGG ID hsa:4893
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
NRAS can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Rhabdomyosarcoma ICD-11: 2B55
Pathway Response Ferroptosis hsa04216
MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
RMS13 cells Rhabdomyosarcoma Mus musculus CVCL_S112
Response regulation Oncogenic RAS (HRAS, NRAS, KRAS) selectively modulates cell death pathways triggered by cytotoxic stimuli in rhabdomyosarcoma RMS13 cells. In conclusion, our discovery of an increased resistance to oxidative stress imposed by oncogenic RAS mutants in RMS13 cells has important implications for the development of targeted therapies for rhabdomyosarcoma (RMS).
Rhabdomyosarcoma [ICD-11: 2B55]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator GTPase NRas (NRAS) Protein coding
Pathway Response Ferroptosis hsa04216
MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
RMS13 cells Rhabdomyosarcoma Mus musculus CVCL_S112
Response regulation Oncogenic RAS (HRAS, NRAS, KRAS) selectively modulates cell death pathways triggered by cytotoxic stimuli in rhabdomyosarcoma RMS13 cells. In conclusion, our discovery of an increased resistance to oxidative stress imposed by oncogenic RAS mutants in RMS13 cells has important implications for the development of targeted therapies for rhabdomyosarcoma (RMS).
References
Ref 1 Oncogenic RAS Mutants Confer Resistance of RMS13 Rhabdomyosarcoma Cells to Oxidative Stress-Induced Ferroptotic Cell Death. Front Oncol. 2015 Jun 22;5:131. doi: 10.3389/fonc.2015.00131. eCollection 2015.