Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10053)
Regulator Name Ceruloplasmin (CP)
Synonyms
Ferroxidase
    Click to Show/Hide
Gene Name CP
Gene ID 1356
Regulator Type Protein coding
Uniprot ID P00450
Sequence
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP
DRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH
SHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH
SHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC
SEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS
SSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV
RFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY
SAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF
SGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR
QSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK
KVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA
INGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP
GTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG

    Click to Show/Hide
Family Multicopper oxidase family
Function
Ceruloplasmin is a blue, copper-binding (6-7 atoms per molecule) glycoprotein. It has ferroxidase activity oxidizing Fe(2+) to Fe(3+) without releasing radical oxygen species. It is involved in iron transport across the cell membrane. Provides Cu(2+) ions for the ascorbate-mediated deaminase degradation of the heparan sulfate chains of GPC1. May also play a role in fetal lung development or pulmonary antioxidant defense.

    Click to Show/Hide
HGNC ID
HGNC:2295
KEGG ID hsa:1356
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CP can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 2 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Responsed Drug RSL3 Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation Erastin and RSL3 suppress ceruloplasmin expression in hepatocellular carcinoma cells. CP suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. The suppression function of ceruloplasmin in erastin- and RSL3-induced ferroptosis is dependent on FPN.
Experiment 2 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation Erastin and RSL3 suppress ceruloplasmin expression in hepatocellular carcinoma cells. CP suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. The suppression function of ceruloplasmin in erastin- and RSL3-induced ferroptosis is dependent on FPN.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Ceruloplasmin (CP) Protein coding
 Regulator Info 
Responsed Drug RSL3 Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation Erastin and RSL3 suppress ceruloplasmin expression in hepatocellular carcinoma cells. CP suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. The suppression function of ceruloplasmin in erastin- and RSL3-induced ferroptosis is dependent on FPN.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Ceruloplasmin (CP) Protein coding
 Regulator Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation Erastin and RSL3 suppress ceruloplasmin expression in hepatocellular carcinoma cells. CP suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. The suppression function of ceruloplasmin in erastin- and RSL3-induced ferroptosis is dependent on FPN.
RSL3 [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation Erastin and RSL3 suppress ceruloplasmin expression in hepatocellular carcinoma cells. CP suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. The suppression function of ceruloplasmin in erastin- and RSL3-induced ferroptosis is dependent on FPN.
Erastin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation Erastin and RSL3 suppress ceruloplasmin expression in hepatocellular carcinoma cells. CP suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. The suppression function of ceruloplasmin in erastin- and RSL3-induced ferroptosis is dependent on FPN.
References
Ref 1 Ceruloplasmin suppresses ferroptosis by regulating iron homeostasis in hepatocellular carcinoma cells. Cell Signal. 2020 Aug;72:109633. doi: 10.1016/j.cellsig.2020.109633. Epub 2020 Apr 10.