Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10043)
Regulator Name DnaJ homolog subfamily B member 6 (DNAJB6)
Synonyms
HSJ2, MRJ, MSJ1; HHDJ1; Heat shock protein J2; MRJ; MSJ-1
    Click to Show/Hide
Gene Name DNAJB6
Gene ID 10049
Regulator Type Protein coding
Uniprot ID O75190
Sequence
MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAK
KRDIYDKYGKEGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFE
DFFGNRRGPRGSRSRGTGSFFSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSF
GGSGMGNFKSISTSTKMVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGVADDDALAE
ERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAG
LKEGGKRKKQKQREESKKKKSTKGNH

    Click to Show/Hide
Function
Has a stimulatory effect on the ATPase activity of HSP70 in a dose-dependent and time-dependent manner and hence acts as a co- chaperone of HSP70. Plays an indispensable role in the organization of KRT8/KRT18 filaments. Acts as an endogenous molecular chaperone for neuronal proteins including huntingtin. Suppresses aggregation and toxicity of polyglutamine- containing, aggregation-prone proteins. Also reduces cellular toxicity and caspase-3 activity.

    Click to Show/Hide
HGNC ID
HGNC:14888
KEGG ID hsa:10049
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
DNAJB6 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Oesophageal cancer ICD-11: 2B70
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 TE-1 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
EC9706 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_E307
Eca-109 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE150 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-450 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
In Vivo Model
Female BALB/c athymic nude mice (4 weeks of age) were obtained from the HFK Bioscience Co, Beijing. To generate murine subcutaneous tumors, 2 x 106 Eca109 cells and KYSE 150 cells in 100 ul PBS were injected subcutaneously on the left of the nude mices dorsal midline. The xenografts were measured every 4 days.

    Click to Show/Hide
Response regulation The correlation between DNAJB6 level and lymph node metastasis in esophageal squamous cell carcinoma (ESCC) patient was negative. Overexpressing DNAJB6a shows tumor-suppressive effects in vitro and in vivo. In addition, DNAJB6a overexpression was accompanied together with a remarkable reduction in the protein levels of GPX4 and phosphorylated AKT (p-AKT).
Oesophageal cancer [ICD-11: 2B70]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator DnaJ homolog subfamily B member 6 (DNAJB6) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 TE-1 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
EC9706 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_E307
Eca-109 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE150 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-450 cells Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
In Vivo Model
Female BALB/c athymic nude mice (4 weeks of age) were obtained from the HFK Bioscience Co, Beijing. To generate murine subcutaneous tumors, 2 x 106 Eca109 cells and KYSE 150 cells in 100 ul PBS were injected subcutaneously on the left of the nude mices dorsal midline. The xenografts were measured every 4 days.

    Click to Show/Hide
Response regulation The correlation between DNAJB6 level and lymph node metastasis in esophageal squamous cell carcinoma (ESCC) patient was negative. Overexpressing DNAJB6a shows tumor-suppressive effects in vitro and in vivo. In addition, DNAJB6a overexpression was accompanied together with a remarkable reduction in the protein levels of GPX4 and phosphorylated AKT (p-AKT).
References
Ref 1 DNAJB6 Promotes Ferroptosis in Esophageal Squamous Cell Carcinoma. Dig Dis Sci. 2020 Jul;65(7):1999-2008. doi: 10.1007/s10620-019-05929-4. Epub 2019 Nov 8.