General Information of the Ferroptosis Regulator (ID: REG10035)
Regulator Name Acyl-CoA (8-3)-desaturase (FADS1)
Synonyms
Delta(5) fatty acid desaturase; Fatty acid desaturase 1
    Click to Show/Hide
Gene Name FADS1
Gene ID 3992
Regulator Type Protein coding
Uniprot ID O60427
Sequence
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVIS
HYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVE
RMGLMKANHVFFLLYLLHILLLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHD
FGHLSVFSTSKWNHLLHHFVIGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFA
LGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQWYIFYFVIQRKKWVDLAWMI
TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQL
QATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
SAFADIIHSLKESGQLWLDAYLHQ

    Click to Show/Hide
Family Fatty acid desaturase type 1 family
Function
Acts as a front-end fatty acyl-coenzyme A (CoA) desaturase that introduces a cis double bond at carbon 5 located between a preexisting double bond and the carboxyl end of the fatty acyl chain. Involved in biosynthesis of highly unsaturated fatty acids (HUFA) from the essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3) precursors. Specifically, desaturates dihomo-gamma-linoleoate (DGLA) (20:3n-6) and eicosatetraenoate (ETA) (20:4n-3) to generate arachidonate (AA) (20:4n-6) and eicosapentaenoate (EPA) (20:5n-3), respectively. As a rate limiting enzyme for DGLA (20:3n-6) and AA (20:4n-6)-derived eicosanoid biosynthesis, controls the metabolism of inflammatory lipids like prostaglandin E2, critical for efficient acute inflammatory response and maintenance of epithelium homeostasis. Contributes to membrane phospholipid biosynthesis by providing AA (20:4n-6) as a major acyl chain esterified into phospholipids. In particular, regulates phosphatidylinositol-4,5-bisphosphate levels, modulating inflammatory cytokine production in T-cells. Also desaturates (11E)- octadecenoate (trans-vaccenoate)(18:1n-9), a metabolite in the biohydrogenation pathway of LA (18:2n-6).

    Click to Show/Hide
HGNC ID
HGNC:3574
KEGG ID hsa:3992
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
FADS1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Gastric cancer ICD-11: 2B72
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN-28 cells Gastric epithelial carcinoma Homo sapiens CVCL_1416
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
NCI-N87 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
SNU-484 cells Gastric adenocarcinoma Homo sapiens CVCL_0100
SNU-601 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_0101
SNU-668 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_5081
SNU-719 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
YCC-6 cells Gastric adenocarcinoma Homo sapiens CVCL_9662
YCC-16 cells Gastric adenocarcinoma Homo sapiens CVCL_9649
Hs746T cells Gastric adenocarcinoma Homo sapiens CVCL_0333
Response regulation The expression of elongation of very long-chain fatty acid protein 5 (ELOVL5) and fatty acid desaturase 1 (FADS1) is up-regulated in mesenchymal-type gastric cancer cells (GCs), leading to ferroptosis sensitization.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Acyl-CoA (8-3)-desaturase (FADS1) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN-28 cells Gastric epithelial carcinoma Homo sapiens CVCL_1416
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
NCI-N87 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
SNU-484 cells Gastric adenocarcinoma Homo sapiens CVCL_0100
SNU-601 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_0101
SNU-668 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_5081
SNU-719 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
YCC-6 cells Gastric adenocarcinoma Homo sapiens CVCL_9662
YCC-16 cells Gastric adenocarcinoma Homo sapiens CVCL_9649
Hs746T cells Gastric adenocarcinoma Homo sapiens CVCL_0333
Response regulation The expression of elongation of very long-chain fatty acid protein 5 (ELOVL5) and fatty acid desaturase 1 (FADS1) is up-regulated in mesenchymal-type gastric cancer cells (GCs), leading to ferroptosis sensitization.
References
Ref 1 Polyunsaturated fatty acid biosynthesis pathway determines ferroptosis sensitivity in gastric cancer. Proc Natl Acad Sci U S A. 2020 Dec 22;117(51):32433-32442. doi: 10.1073/pnas.2006828117. Epub 2020 Dec 7.