Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10018)
Regulator Name Telomerase reverse transcriptase (TERT)
Synonyms
EST2, TCS1, TRT; HEST2; Telomerase catalytic subunit; Telomerase-associated protein 2
    Click to Show/Hide
Gene Name TERT
Gene ID 7015
Regulator Type Protein coding
Uniprot ID O14746
Sequence
MPRAPRCRAVRSLLRSHYREVLPLATFVRRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW
DARPPPAAPSFRQVSCLKELVARVLQRLCERGAKNVLAFGFALLDGARGGPPEAFTTSVR
SYLPNTVTDALRGSGAWGLLLRRVGDDVLVHLLARCALFVLVAPSCAYQVCGPPLYQLGA
ATQARPPPHASGPRRRLGCERAWNHSVREAGVPLGLPAPGARRRGGSASRSLPLPKRPRR
GAAPEPERTPVGQGSWAHPGRTRGPSDRGFCVVSPARPAEEATSLEGALSGTRHSHPSVG
RQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRL
VETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVT
PAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGS
RHNERRFLRNTKKFISLGKHAKLSLQELTWKMSVRDCAWLRRSPGVGCVPAAEHRLREEI
LAKFLHWLMSVYVVELLRSFFYVTETTFQKNRLFFYRKSVWSKLQSIGIRQHLKRVQLRE
LSEAEVRQHREARPALLTSRLRFIPKPDGLRPIVNMDYVVGARTFRREKRAERLTSRVKA
LFSVLNYERARRPGLLGASVLGLDDIHRAWRTFVLRVRAQDPPPELYFVKVDVTGAYDTI
PQDRLTEVIASIIKPQNTYCVRRYAVVQKAAHGHVRKAFKSHVSTLTDLQPYMRQFVAHL
QETSPLRDAVVIEQSSSLNEASSGLFDVFLRFMCHHAVRIRGKSYVQCQGIPQGSILSTL
LCSLCYGDMENKLFAGIRRDGLLLRLVDDFLLVTPHLTHAKTFLRTLVRGVPEYGCVVNL
RKTVVNFPVEDEALGGTAFVQMPAHGLFPWCGLLLDTRTLEVQSDYSSYARTSIRASLTF
NRGFKAGRNMRRKLFGVLRLKCHSLFLDLQVNSLQTVCTNIYKILLLQAYRFHACVLQLP
FHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLL
KLTRHRVTYVPLLGSLRTAQTQLSRKLPGTTLTALEAAANPALPSDFKTILD

    Click to Show/Hide
Family Reverse transcriptase family
Function
Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex- associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis.

    Click to Show/Hide
HGNC ID
HGNC:11730
KEGG ID hsa:7015
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TERT can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Lung injury ICD-11: NB32
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MLE-12 cells Normal Mus musculus CVCL_3751
In Vivo Model
We received 60 C57BL/6J mice and 48 Nrf2 knockout (Nrf2-/-) mice of the same genetic background from the RIKEN Bio-Resource Centre via the National BioResource Project, MEXT, Japan. Intestinal ischemia was simulated by clamping the superior mesenteric artery following the intraperitoneal administration of 50 mg/kg sodium pentobarbital. Forty-five minutes later, the intestine was allowed to re-perfuse for 3 h.

    Click to Show/Hide
Response regulation Nrf2 can negatively regulate ferroptosis via modulation of TERT and SLC7A11 levels. Overexpression of TERT (OETERT) alleviates ferroptosis via modulation of SLC7A11. The conclusion from this study brings insight into new candidates that can be targeted in future ischemia/reperfusion-induced acute lung injury (IIR-ALI) therapy.
Lung injury [ICD-11: NB32]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Telomerase reverse transcriptase (TERT) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MLE-12 cells Normal Mus musculus CVCL_3751
In Vivo Model
We received 60 C57BL/6J mice and 48 Nrf2 knockout (Nrf2-/-) mice of the same genetic background from the RIKEN Bio-Resource Centre via the National BioResource Project, MEXT, Japan. Intestinal ischemia was simulated by clamping the superior mesenteric artery following the intraperitoneal administration of 50 mg/kg sodium pentobarbital. Forty-five minutes later, the intestine was allowed to re-perfuse for 3 h.

    Click to Show/Hide
Response regulation Nrf2 can negatively regulate ferroptosis via modulation of TERT and SLC7A11 levels. Overexpression of TERT (OETERT) alleviates ferroptosis via modulation of SLC7A11. The conclusion from this study brings insight into new candidates that can be targeted in future ischemia/reperfusion-induced acute lung injury (IIR-ALI) therapy.
References
Ref 1 Nrf2 attenuates ferroptosis-mediated IIR-ALI by modulating TERT and SLC7A11. Cell Death Dis. 2021 Oct 29;12(11):1027. doi: 10.1038/s41419-021-04307-1.