General Information of the Ferroptosis Regulator (ID: REG10001)
Regulator Name Putative metallothionein MT1DP (MT1DP)
Synonyms
MTM
    Click to Show/Hide
Gene Name MT1DP
Gene ID 326343
Regulator Type Protein coding
Uniprot ID A1L3X4
Sequence
MDLSCSCATGGSCTCASSCKCKEYKCTSCKKNCCSCCPMGCAKCAQGCT

    Click to Show/Hide
Family Metallothionein superfamily
Function
Metallothioneins have a high content of cysteine residues that bind various heavy metals.

    Click to Show/Hide
HGNC ID
HGNC:7396
KEGG ID hsa:326343
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MT1DP can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Lung cancer ICD-11: 2C25
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
In Vivo Model
A total of 6 x 106 A549 cells were subcutaneously injected into the right flank of the athymic BALB/c nude mice (aged 4 weeks, weight 12-16 g; Vital River, Beijing, China). Once tumors reached about 80 mm3, the mice were randomly divided into four groups. Mice were treated with 50 uM/kg erastin by intraperitoneal injection every 2 days for eight times. Tumor size was measured.

    Click to Show/Hide
Response regulation Previous findings indicated that metallothionein 1D pseudogene (MT1DP), a long noncoding RNA (lncRNA), functioned to aggravate oxidative stress by repressing antioxidation. RNA pulldown assay and dual-luciferase reporter assay confirmed that MT1DP modulated the expression of NRF2 via stabilizing miR-365a-3p. In conclusion, MT1DP sensitized non-small cell lung cancer (NSCLC) cells to erastin-induced ferroptosis by regulating the miR-365a-3p/NRF2 signaling pathway.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Putative metallothionein MT1DP (MT1DP) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
In Vivo Model
A total of 6 x 106 A549 cells were subcutaneously injected into the right flank of the athymic BALB/c nude mice (aged 4 weeks, weight 12-16 g; Vital River, Beijing, China). Once tumors reached about 80 mm3, the mice were randomly divided into four groups. Mice were treated with 50 uM/kg erastin by intraperitoneal injection every 2 days for eight times. Tumor size was measured.

    Click to Show/Hide
Response regulation Previous findings indicated that metallothionein 1D pseudogene (MT1DP), a long noncoding RNA (lncRNA), functioned to aggravate oxidative stress by repressing antioxidation. RNA pulldown assay and dual-luciferase reporter assay confirmed that MT1DP modulated the expression of NRF2 via stabilizing miR-365a-3p. In conclusion, MT1DP sensitized non-small cell lung cancer (NSCLC) cells to erastin-induced ferroptosis by regulating the miR-365a-3p/NRF2 signaling pathway.
References
Ref 1 MT1DP loaded by folate-modified liposomes sensitizes erastin-induced ferroptosis via regulating miR-365a-3p/NRF2 axis in non-small cell lung cancer cells. Cell Death Dis. 2020 Sep 14;11(9):751. doi: 10.1038/s41419-020-02939-3.