Ferroptosis Target Information
General Information of the Ferroptosis Target (ID: TAR10064)
| Target Name | Glutathione peroxidase 1 (GPX1) | ||||
|---|---|---|---|---|---|
| Synonyms |
GPx-1; GSHPx-1; Cellular glutathione peroxidase
Click to Show/Hide
|
||||
| Gene Name | GPX1 | ||||
| Sequence |
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS RRFQTIDIEPDIEALLSQGPSCA Click to Show/Hide
|
||||
| Family | Glutathione peroxidase family | ||||
| Function |
Protects the hemoglobin in erythrocytes from oxidative breakdown. In platelets, plays a crucial role of glutathione peroxidase in the arachidonic acid metabolism.
Click to Show/Hide
|
||||
| Gene ID | 2876 | ||||
| Uniprot ID | |||||
| Target Type | Driver Suppressor Marker | ||||
| Mechanism Diagram | Click to View the Original Diagram | ||||
|
|||||
Tissue Relative Abundances of This Target
Full List of Regulator(s) of This Ferroptosis Target and Corresponding Disease/Drug Response(s)
GPX1 can be involved in and affect the ferroptosis by the following regulators, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulting from the regulation of certain regulators.
Browse Regulator related Disease
Browse Regulator related Drug
Unspecific Regulator
Cerebral ischemia [ICD-11: 8B10]
| In total 1 item(s) under this disease | |||||
| Experiment 1 Reporting the Ferroptosis-centered Disease Response of This Regulator | [1] | ||||
| Responsed Drug | Berberine | Investigative | |||
| Pathway Response | Glutathione metabolism | hsa00480 | |||
| Ferroptosis | hsa04216 | ||||
| Cell Process | Cell ferroptosis | ||||
In Vitro Model |
hBCs (Brain cells) | ||||
| In Vivo Model |
All animal experiments described in this study were carried out in accordance with the U.K. Animals (Scientific Procedures) Act and were approved by the Experimental Animal Center of Wenzhou Medical University (No. wydw2022-0032). Six-to-eight-weeks old male ICR mice were obtained from Beijing Weitonglihua Experimental Animal Technology Co. Ltd. (Beijing, China). Mice were group-housed in the breeding environment under a 12/12h light/dark cycle, controlled temperature of 20-22 and 50-60% humidity with ad libitum chow and water. All animals were randomized for the research and procedures.
Click to Show/Hide
|
||||
| Response Description | This study revealed the therapeutic potential of berberine on cerebral ischemia-reperfusion injury via inhibiting neuronal ferroptosis, in which upregulated glutathione peroxidase 1 (GPX1) was possibly involved. | ||||
Unspecific Regulator
Berberine
[Investigative]
| In total 1 item(s) under this drug | |||||
| Experiment 1 Reporting the Ferroptosis-centered Drug Response of This Regulator | [1] | ||||
| Responsed Disease | Cerebral ischemia [ICD-11: 8B10] | ||||
| Pathway Response | Glutathione metabolism | hsa00480 | |||
| Ferroptosis | hsa04216 | ||||
| Cell Process | Cell ferroptosis | ||||
| In Vitro Model | hBCs (Brain cells) | ||||
| In Vivo Model |
All animal experiments described in this study were carried out in accordance with the U.K. Animals (Scientific Procedures) Act and were approved by the Experimental Animal Center of Wenzhou Medical University (No. wydw2022-0032). Six-to-eight-weeks old male ICR mice were obtained from Beijing Weitonglihua Experimental Animal Technology Co. Ltd. (Beijing, China). Mice were group-housed in the breeding environment under a 12/12h light/dark cycle, controlled temperature of 20-22 and 50-60% humidity with ad libitum chow and water. All animals were randomized for the research and procedures.
Click to Show/Hide
|
||||
| Response Description | This study revealed the therapeutic potential of berberine on cerebral ischemia-reperfusion injury via inhibiting neuronal ferroptosis, in which upregulated glutathione peroxidase 1 (GPX1) was possibly involved. | ||||