Ferroptosis Target Information

General Information of the Ferroptosis Target (ID: TAR10014)
Target Name Ubiquitin carboxyl-terminal hydrolase BAP1 (BAP1)
Synonyms
BRCA1-associated protein 1 ; Cerebral protein 6
    Click to Show/Hide
Gene Name BAP1
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANR
APAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVE
KEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ

    Click to Show/Hide
Family Peptidase C12 family
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). Does not deubiquitinate monoubiquitinated histone H2B. Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains . Deubiquitination of HCFC1 does not lead to increase stability of HCFC1 . Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination. It however does not mediate deubiquitination of BRCA1 and BARD1. Able to mediate autodeubiquitination via intramolecular interactions to couteract monoubiquitination at the nuclear localization signal (NLS), thereby protecting it from cytoplasmic sequestration. Acts as a tumor suppressor.

    Click to Show/Hide
Gene ID 8314
Uniprot ID
Q92560
Target Type Driver Suppressor Marker
Mechanism Diagram Click to View the Original Diagram
Tissue Relative Abundances of This Target
Full List of Regulator(s) of This Ferroptosis Target and Corresponding Disease/Drug Response(s)
BAP1 can be involved in and affect the ferroptosis by the following regulators, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulting from the regulation of certain regulators.
Browse Regulator related Disease
NEAT1 (IncRNA)
 Regulator Info 
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the Ferroptosis-centered Disease Response of This Regulator [1]
Regulator for Ferroptosis Driver
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SK-N-SH cells Neuroblastoma Homo sapiens CVCL_0531
Response Description Dysregulated ferroptosis is closely associated with Parkinson's disease (PD) progression. NEAT1 functioned as a sponge to suppress miR-150-5p expression. Moreover, miR-150-5p overexpression suppressed ferroptosis in PD cell model. And miR-150-5p regulated SLC7A11 expression by directly binding to BAP1.
hsa-miR-150-5p (miRNA)
 Regulator Info 
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the Ferroptosis-centered Disease Response of This Regulator [1]
Regulator for Ferroptosis Suppressor
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SK-N-SH cells Neuroblastoma Homo sapiens CVCL_0531
Response Description Dysregulated ferroptosis is closely associated with Parkinson's disease (PD) progression. NEAT1 functioned as a sponge to suppress miR-150-5p expression. Moreover, miR-150-5p overexpression suppressed ferroptosis in PD cell model. And miR-150-5p regulated SLC7A11 expression by directly binding to BAP1.
References
Ref 1 LncRNA NEAT1 promoted MPP+induced ferroptosis via regulating miR1505p/BAP1 pathway in SKNSH cells. Acta Neurobiol Exp (Wars). 2022;82(2):226-236. doi: 10.55782/ane-2022-021.