General Information of the Ferroptosis Regulator (ID: REG10484)
Regulator Name Integrin beta-8 (ITGB8)
Gene Name ITGB8
Gene ID 3696
Regulator Type Protein coding
Uniprot ID P26012
Sequence
MCGSALAFFTAAFVCLQNDRRGPASFLWAAWVFSLVLGLGQGEDNRCASSNAASCARCLA
LGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTP
GEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFF
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
TIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCR
NVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGK
CVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGK
VYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQV
CSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTS
CALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSS
DYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF

    Click to Show/Hide
Family Integrin beta chain family
Function
Integrin alpha-V:beta-8 (ITGAV:ITGB8) is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligands. Integrin alpha-V:beta-6 (ITGAV:ITGB6) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation on the surface of activated regulatory T-cells (Tregs) (Probable). Required during vasculogenesis (By similarity).

    Click to Show/Hide
HGNC ID
HGNC:6163
KEGG ID hsa:3696
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ITGB8 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Glioblastoma ICD-11: 2A00
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell invasion
In Vitro Model
LN-229 cells Glioblastoma Homo sapiens CVCL_0393
U-251MG cells Astrocytoma Homo sapiens CVCL_0021
In Vivo Model
The stably transfected LN229 cells were set up via the lentivirus-mediation of sh-circ-TTBK2 or sh-NC. Then, the stably transfected LN229 cells (2 x 106 ) were injected into the Balb/c nude mice (4 weeks old, n = 6/group) subcutaneously, which were purchased from Vital River Laboratory Animal Technology (Beijing, China).

    Click to Show/Hide
Response regulation Levels of circ-TTBK2 and ITGB8 were upregulated, whereas miR-761 level was low-expressed in glioma tissues and cells. Circ-TTBK2 was a sponge of miR-761 to modulate ITGB8. Additionally, circ-TTBK2 knockdown or miR-761 increase could retard cell proliferation, invasion, and promote ferroptosis in glioma cells.
Glioblastoma [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Integrin beta-8 (ITGB8) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell invasion
In Vitro Model
LN-229 cells Glioblastoma Homo sapiens CVCL_0393
U-251MG cells Astrocytoma Homo sapiens CVCL_0021
In Vivo Model
The stably transfected LN229 cells were set up via the lentivirus-mediation of sh-circ-TTBK2 or sh-NC. Then, the stably transfected LN229 cells (2 x 106 ) were injected into the Balb/c nude mice (4 weeks old, n = 6/group) subcutaneously, which were purchased from Vital River Laboratory Animal Technology (Beijing, China).

    Click to Show/Hide
Response regulation Levels of circ-TTBK2 and ITGB8 were upregulated, whereas miR-761 level was low-expressed in glioma tissues and cells. Circ-TTBK2 was a sponge of miR-761 to modulate ITGB8. Additionally, circ-TTBK2 knockdown or miR-761 increase could retard cell proliferation, invasion, and promote ferroptosis in glioma cells.
References
Ref 1 Circular RNA TTBK2 regulates cell proliferation, invasion and ferroptosis via miR-761/ITGB8 axis in glioma. Eur Rev Med Pharmacol Sci. 2020 Mar;24(5):2585-2600. doi: 10.26355/eurrev_202003_20528.