General Information of the Ferroptosis Regulator (ID: REG10476)
Regulator Name Peroxiredoxin-2 (PRDX2)
Synonyms
NKEFB; TDPX1; Natural killer cell-enhancing factor B; PRP; Thiol-specific antioxidant protein; Thioredoxin peroxidase 1; Thioredoxin-dependent peroxide reductase 1; Thioredoxin-dependent peroxiredoxin 2
    Click to Show/Hide
Gene Name PRDX2
Gene ID 7001
Regulator Type Protein coding
Uniprot ID P32119
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN

    Click to Show/Hide
Family Peroxiredoxin family
Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).

    Click to Show/Hide
HGNC ID
HGNC:9353
KEGG ID hsa:7001
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PRDX2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Lung cancer ICD-11: 2C25
Responsed Drug 11-hydroxy-ent-16-kaurene-15-one Investigative
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
HBE1 cells Normal Homo sapiens CVCL_0287
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
HUVECs (Human umbilical vein endothelial cells)
In Vivo Model
Thirty male athymic (Balb/c-nu) mice (4-week-old) were purchased from the SPF (Beijing) biotechnology (Beijing, China) and allowed to acclimatize for 1 week. A549/CDDP cells (5 x 106 cells) were injected subcutaneously into the right anterior flanks of the mice. Two weeks after the injection of cells, when the tumors became palpable (around 100 mm3), mice were randomly divided into four groups (n = 6 per group). Tumor-bearing mice were received equal amount of solvent, CDDP (4 mg/kg) or compound 23 (10 mg/kg) or combination CDDP and 23 were injected via intraperitoneal injection. Administration was performed every 3 days for 30 days.

    Click to Show/Hide
Response regulation 11-hydroxy-ent-16-kaurene-15-one possessed strong inhibitory activity against several cancer cell lines. Moreover, compound 23 induced both apoptosis and ferroptosis through increasing cellular ROS levels in HepG2 cells. ROS accumulation induced by compound 23 was caused by inhibition of antioxidant systems through targeting peroxiredoxin II (Prdx II) and depletion of GSH in lung adenocarcinoma cells.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Peroxiredoxin-2 (PRDX2) Protein coding
Responsed Drug 11-hydroxy-ent-16-kaurene-15-one Investigative
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
HBE1 cells Normal Homo sapiens CVCL_0287
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
HUVECs (Human umbilical vein endothelial cells)
In Vivo Model
Thirty male athymic (Balb/c-nu) mice (4-week-old) were purchased from the SPF (Beijing) biotechnology (Beijing, China) and allowed to acclimatize for 1 week. A549/CDDP cells (5 x 106 cells) were injected subcutaneously into the right anterior flanks of the mice. Two weeks after the injection of cells, when the tumors became palpable (around 100 mm3), mice were randomly divided into four groups (n = 6 per group). Tumor-bearing mice were received equal amount of solvent, CDDP (4 mg/kg) or compound 23 (10 mg/kg) or combination CDDP and 23 were injected via intraperitoneal injection. Administration was performed every 3 days for 30 days.

    Click to Show/Hide
Response regulation 11-hydroxy-ent-16-kaurene-15-one possessed strong inhibitory activity against several cancer cell lines. Moreover, compound 23 induced both apoptosis and ferroptosis through increasing cellular ROS levels in HepG2 cells. ROS accumulation induced by compound 23 was caused by inhibition of antioxidant systems through targeting peroxiredoxin II (Prdx II) and depletion of GSH in lung adenocarcinoma cells.
11-hydroxy-ent-16-kaurene-15-one [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Lung cancer ICD-11: 2C25
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
HBE1 cells Normal Homo sapiens CVCL_0287
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
HUVECs (Human umbilical vein endothelial cells)
In Vivo Model
Thirty male athymic (Balb/c-nu) mice (4-week-old) were purchased from the SPF (Beijing) biotechnology (Beijing, China) and allowed to acclimatize for 1 week. A549/CDDP cells (5 x 106 cells) were injected subcutaneously into the right anterior flanks of the mice. Two weeks after the injection of cells, when the tumors became palpable (around 100 mm3), mice were randomly divided into four groups (n = 6 per group). Tumor-bearing mice were received equal amount of solvent, CDDP (4 mg/kg) or compound 23 (10 mg/kg) or combination CDDP and 23 were injected via intraperitoneal injection. Administration was performed every 3 days for 30 days.

    Click to Show/Hide
Response regulation 11-hydroxy-ent-16-kaurene-15-one possessed strong inhibitory activity against several cancer cell lines. Moreover, compound 23 induced both apoptosis and ferroptosis through increasing cellular ROS levels in HepG2 cells. ROS accumulation induced by compound 23 was caused by inhibition of antioxidant systems through targeting peroxiredoxin II (Prdx II) and depletion of GSH in lung adenocarcinoma cells.
References
Ref 1 ent-Kaurane diterpenoids induce apoptosis and ferroptosis through targeting redox resetting to overcome cisplatin resistance. Redox Biol. 2021 Jul;43:101977. doi: 10.1016/j.redox.2021.101977. Epub 2021 Apr 16.