Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10464)
Regulator Name Poly(rC)-binding protein 3 (PCBP3)
Synonyms
Alpha-CP3; PCBP3-overlapping transcript; PCBP3-overlapping transcript 1
    Click to Show/Hide
Gene Name PCBP3
Regulator Type Protein coding
Uniprot ID P57721
Sequence
MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSI
IGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMS
NSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTI
SGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQ
LTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
PNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINAR
LTSEVTGMGTL

    Click to Show/Hide
Function
Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.

    Click to Show/Hide
HGNC ID
HGNC:8651
KEGG ID hsa:54039
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PCBP3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Ferroptosis hsa04216
PI3K-Akt signaling pathway hsa04151
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
HPDE cells Normal Homo sapiens CVCL_4376
In Vivo Model
Male BALB/c nude mice (5 weeks old; 16-18 g) were obtained from the Animal Center of Guangxi Medical University and grown under specific pathogen-free conditions. The mice (n = 20) were randomly divided into four groups; Vector group, A2M-AS1 group, Vector + Erastin group, and A2M-AS1 + Erastin group. The Vector and Vector + Erastin groups were injected with 106 cells that stably expressing the lentiviral vector, whereas the other two groups were injected with 106 cells that stably overexpressing A2M-AS1. On the 7th day after inoculation, the Vector + Erastin and A2M-AS1 + Erastin groups were intraperitoneally injected with a 100-uL Erastin solution (40 mg/kg) once every 2 days.

    Click to Show/Hide
Response regulation A2M-AS1 could directly interact with the poly (rC) binding protein 3 (PCBP3), which plays an important role in the process of iron metabolism, thereby promoting the ferroptosis in pancreatic cancer.
Pancreatic cancer [ICD-11: 2C10]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Poly(rC)-binding protein 3 (PCBP3) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
PI3K-Akt signaling pathway hsa04151
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
HPDE cells Normal Homo sapiens CVCL_4376
In Vivo Model
Male BALB/c nude mice (5 weeks old; 16-18 g) were obtained from the Animal Center of Guangxi Medical University and grown under specific pathogen-free conditions. The mice (n = 20) were randomly divided into four groups; Vector group, A2M-AS1 group, Vector + Erastin group, and A2M-AS1 + Erastin group. The Vector and Vector + Erastin groups were injected with 106 cells that stably expressing the lentiviral vector, whereas the other two groups were injected with 106 cells that stably overexpressing A2M-AS1. On the 7th day after inoculation, the Vector + Erastin and A2M-AS1 + Erastin groups were intraperitoneally injected with a 100-uL Erastin solution (40 mg/kg) once every 2 days.

    Click to Show/Hide
Response regulation A2M-AS1 could directly interact with the poly (rC) binding protein 3 (PCBP3), which plays an important role in the process of iron metabolism, thereby promoting the ferroptosis in pancreatic cancer.
References
Ref 1 LncRNA A2M-AS1 Promotes Ferroptosis in Pancreatic Cancer via Interacting With PCBP3. Mol Cancer Res. 2022 Nov 3;20(11):1636-1645. doi: 10.1158/1541-7786.MCR-22-0024.