Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10454)
Regulator Name GA-binding protein subunit beta-1 (GABPB1)
Synonyms
GABP subunit beta-2; Nuclear respiratory factor 2; Transcription factor E4TF1-47; Transcription factor E4TF1-53
    Click to Show/Hide
Gene Name GABPB1
Gene ID 2553
Regulator Type Protein coding
Uniprot ID Q06547
Sequence
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNS
SETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVT
MPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANRE
AQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV

    Click to Show/Hide
Function
Transcription factor capable of interacting with purine rich repeats (GA repeats). Acts as a a master regulator of nuclear-encoded mitochondrial genes (By similarity).; (Microbial infection) Necessary for the expression of the Adenovirus E4 gene.

    Click to Show/Hide
HGNC ID
HGNC:4074
KEGG ID hsa:2553
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
GABPB1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Response regulation Erastin upregulated the lncRNA GABPB1-AS1, which downregulated GABPB1 protein levels by blocking GABPB1 translation, leading to the downregulation of the gene encoding Peroxiredoxin-5 (PRDX5) peroxidase and the eventual suppression of the cellular antioxidant capacity. GABPB1 and GABPB1-AS1 are attractive therapeutic targets for hepatocellular carcinoma.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator GA-binding protein subunit beta-1 (GABPB1) Protein coding
 Regulator Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Response regulation Erastin upregulated the lncRNA GABPB1-AS1, which downregulated GABPB1 protein levels by blocking GABPB1 translation, leading to the downregulation of the gene encoding Peroxiredoxin-5 (PRDX5) peroxidase and the eventual suppression of the cellular antioxidant capacity. GABPB1 and GABPB1-AS1 are attractive therapeutic targets for hepatocellular carcinoma.
Erastin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Response regulation Erastin upregulated the lncRNA GABPB1-AS1, which downregulated GABPB1 protein levels by blocking GABPB1 translation, leading to the downregulation of the gene encoding Peroxiredoxin-5 (PRDX5) peroxidase and the eventual suppression of the cellular antioxidant capacity. GABPB1 and GABPB1-AS1 are attractive therapeutic targets for hepatocellular carcinoma.
References
Ref 1 LncRNA GABPB1-AS1 and GABPB1 regulate oxidative stress during erastin-induced ferroptosis in HepG2 hepatocellular carcinoma cells. Sci Rep. 2019 Nov 7;9(1):16185. doi: 10.1038/s41598-019-52837-8.