Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10453)
Regulator Name Transcription factor SOX-4 (SOX4)
Gene Name SOX4
Gene ID 6659
Regulator Type Protein coding
Uniprot ID Q06945
Sequence
MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIK
RPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHM
ADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGGGGGSSNAGGG
GGGASGGGANSKPAQKKSCGSKVAGGAGGGVSKPHAKLILAGGGGGGKAAAAAAASFAAE
QAGAAALLPLGAAADHHSLYKARTPSASASASSAASASAALAAPGKHLAEKKVKRVYLFG
GLGTSSSPVGGVGAGADPSDPLGLYEEEGAGCSPDAPSLSGRSSAASSPAAGRSPADHRG
YASLRAASPAPSSAPSHASSSASSHSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLG
SFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY

    Click to Show/Hide
Function
Transcriptional activator that binds with high affinity to the T-cell enhancer motif 5'-AACAAAG-3' motif. Required for IL17A-producing Vgamma2-positive gamma-delta T-cell maturation and development, via binding to regulator loci of RORC to modulate expression (By similarity). Involved in skeletal myoblast differentiation by promoting gene expression of CALD1.

    Click to Show/Hide
HGNC ID
HGNC:11200
KEGG ID hsa:6659
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SOX4 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Responsed Drug XAV939 Preclinical
 Drug Info 
Pathway Response Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell proliferation
Cell apoptosis
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
Response regulation The downregulation of the lncRNA MIR503HG induced by XAV939 may serve an important role in suppressing the progression of non-small cell lung cancer via sponging miR1273c, to downregulate its target SOX4. Furthermore, the downregulation of SLC7A11 induced by XAV939 may inhibit NSCLC development via participation in the ferroptosis pathway.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Transcription factor SOX-4 (SOX4) Protein coding
 Regulator Info 
Responsed Drug XAV939 Preclinical
 Drug Info 
Pathway Response Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell proliferation
Cell apoptosis
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
Response regulation The downregulation of the lncRNA MIR503HG induced by XAV939 may serve an important role in suppressing the progression of non-small cell lung cancer via sponging miR1273c, to downregulate its target SOX4. Furthermore, the downregulation of SLC7A11 induced by XAV939 may inhibit NSCLC development via participation in the ferroptosis pathway.
XAV939 [Preclinical]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell proliferation
Cell apoptosis
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
Response regulation The downregulation of the lncRNA MIR503HG induced by XAV939 may serve an important role in suppressing the progression of non-small cell lung cancer via sponging miR1273c, to downregulate its target SOX4. Furthermore, the downregulation of SLC7A11 induced by XAV939 may inhibit NSCLC development via participation in the ferroptosis pathway.
References
Ref 1 RNA sequencing uncovers the key long non-coding RNAs and potential molecular mechanism contributing to XAV939-mediated inhibition of non-small cell lung cancer. Oncol Lett. 2019 Jun;17(6):4994-5004. doi: 10.3892/ol.2019.10191. Epub 2019 Mar 27.