Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10445)
Regulator Name Pre-mRNA-splicing regulator WTAP (WTAP)
Synonyms
Female-lethal(2)D homolog; WT1-associated protein; Wilms tumor 1-associating protein
    Click to Show/Hide
Gene Name WTAP
Gene ID 9589
Regulator Type Protein coding
Uniprot ID Q15007
Sequence
MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE
KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF
FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI
AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ
QQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE
DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSH
DPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL

    Click to Show/Hide
Family Fl(2)d family
Function
Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing. Required for accumulation of METTL3 and METTL14 to nuclear speckle. Acts as a mRNA splicing regulator. Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability. Impairs WT1 DNA-binding ability and inhibits expression of WT1 target genes.

    Click to Show/Hide
HGNC ID
HGNC:16846
KEGG ID hsa:9589
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
WTAP can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
ZR-75-30 cells Breast carcinoma Homo sapiens CVCL_1661
T-47D cells Invasive breast carcinoma Homo sapiens CVCL_0553
BT-549 cells Invasive breast carcinoma Homo sapiens CVCL_1092
MCF-10A cells Normal Homo sapiens CVCL_0598
Response regulation WTAP knockdown promoted ferroptosis to suppress triple-negative breast cancer (TNBC) cell malignant behaviors, which were abrogated by NUPR1 overexpression. WTAP upregulated LCN2 by regulation of NUPR1 m6A modification, thereby suppressing ferroptosis to contribute to accelerate TNBC progression.
Breast cancer [ICD-11: 2C60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Pre-mRNA-splicing regulator WTAP (WTAP) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
ZR-75-30 cells Breast carcinoma Homo sapiens CVCL_1661
T-47D cells Invasive breast carcinoma Homo sapiens CVCL_0553
BT-549 cells Invasive breast carcinoma Homo sapiens CVCL_1092
MCF-10A cells Normal Homo sapiens CVCL_0598
Response regulation WTAP knockdown promoted ferroptosis to suppress triple-negative breast cancer (TNBC) cell malignant behaviors, which were abrogated by NUPR1 overexpression. WTAP upregulated LCN2 by regulation of NUPR1 m6A modification, thereby suppressing ferroptosis to contribute to accelerate TNBC progression.
References
Ref 1 WTAP Mediates NUPR1 Regulation of LCN2 Through m(6)A Modification to Influence Ferroptosis, Thereby Promoting Breast Cancer Proliferation, Migration and Invasion. Biochem Genet. 2023 Jul 21. doi: 10.1007/s10528-023-10423-8. Online ahead of print.