Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10438)
Regulator Name Neuroepithelial cell-transforming gene 1 protein (NET1)
Synonyms
ARHGEF8; Proto-oncogene p65 Net1; Rho guanine nucleotide exchange factor 8
    Click to Show/Hide
Gene Name NET1
Gene ID 10276
Regulator Type Protein coding
Uniprot ID Q7Z628
Sequence
MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDINLKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSHT
LQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRAST
VSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV

    Click to Show/Hide
Function
Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. May be involved in activation of the SAPK/JNK pathway Stimulates genotoxic stress-induced RHOB activity in breast cancer cells leading to their cell death.

    Click to Show/Hide
HGNC ID
HGNC:14592
KEGG ID hsa:10276
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
NET1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Myeloid leukaemia ICD-11: 2B33
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Gluconeogenesis hsa00010
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell proliferation
Cell apoptosis
In Vitro Model
 Kasumi-1 cells Acute myeloid leukemia Homo sapiens CVCL_0589
KG-1 cells Adult acute myeloid leukemia Homo sapiens CVCL_0374
Response regulation Circ_0000745 promoted cell cycle progression and glycolytic metabolism and inhibited the apoptosis and ferroptosis of acute lymphoblastic leukemia cells by regulating miR-494-3p/ NET1 axis. Circ_0000745/miR-494-3p/ NET1 axis may provide novel potential targets for the diagnosis and treatment of acute lymphoblastic leukemia (ALL).
Myeloid leukaemia [ICD-11: 2B33]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Neuroepithelial cell-transforming gene 1 protein (NET1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Gluconeogenesis hsa00010
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell proliferation
Cell apoptosis
In Vitro Model
 Kasumi-1 cells Acute myeloid leukemia Homo sapiens CVCL_0589
KG-1 cells Adult acute myeloid leukemia Homo sapiens CVCL_0374
Response regulation Circ_0000745 promoted cell cycle progression and glycolytic metabolism and inhibited the apoptosis and ferroptosis of acute lymphoblastic leukemia cells by regulating miR-494-3p/ NET1 axis. Circ_0000745/miR-494-3p/ NET1 axis may provide novel potential targets for the diagnosis and treatment of acute lymphoblastic leukemia (ALL).
References
Ref 1 Circ_0000745 promotes acute lymphoblastic leukemia progression through mediating miR-494-3p/NET1 axis. Hematology. 2022 Dec;27(1):11-22. doi: 10.1080/16078454.2021.2008590.