Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10430)
Regulator Name Zinc transporter SLC39A7 (SLC39A7)
Synonyms
HKE4; Histidine-rich membrane protein Ke4; Really interesting new gene 5 protein; Solute carrier family 39 member 7; Zrt-, Irt-like protein 7
    Click to Show/Hide
Gene Name SLC39A7
Gene ID 7922
Regulator Type Protein coding
Uniprot ID Q92504
Sequence
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH
AHGHGHTHESIWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGES
GAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGL
LGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV
KGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP
VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEV
PHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE

    Click to Show/Hide
Family ZIP transporter family
Function
Transports Zn(2+) from the endoplasmic reticulum (ER)/Golgi apparatus to the cytosol, playing an essential role in the regulation of cytosolic zinc levels. Acts as gatekeeper of zinc release from intracellular stores, requiring post-translational activation by phosphorylation, resulting in activation of multiple downstream pathways leading to cell growth and proliferation. Has an essential role in B cell development and is required for proper B cell receptor signaling. Plays an important role in maintaining intestinal epithelial homeostasis and skin dermis development by regulating ER function (By similarity). Controls cell signaling pathways involved in glucose metabolism in skeletal muscle (By similarity). Has a protective role against ER stress in different biological contexts. Mediates Zn(2+)-induced ferroptosis.

    Click to Show/Hide
HGNC ID
HGNC:4927
KEGG ID hsa:7922
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SLC39A7 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
Response regulation Zinc is also essential for ferroptosis in breast cancer and renal cancer cells. The study identified SLC39A7, encoding ZIP7 that controls zinc transport from endoplasmic reticulum (ER) to cytosol, as a novel genetic determinant of ferroptosis.
Breast cancer [ICD-11: 2C60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Zinc transporter SLC39A7 (SLC39A7) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
Response regulation Zinc is also essential for ferroptosis in breast cancer and renal cancer cells. The study identified SLC39A7, encoding ZIP7 that controls zinc transport from endoplasmic reticulum (ER) to cytosol, as a novel genetic determinant of ferroptosis.
References
Ref 1 Zinc transporter ZIP7 is a novel determinant of ferroptosis. Cell Death Dis. 2021 Feb 19;12(2):198. doi: 10.1038/s41419-021-03482-5.