Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10421)
Regulator Name F-box-like/WD repeat-containing protein TBL1XR1 (TBL1XR1)
Synonyms
IRA1; TBLR1; Nuclear receptor corepressor/HDAC3 complex subunit TBLR1; TBL1-related protein 1; Transducin beta-like 1X-related protein 1
    Click to Show/Hide
Gene Name TBL1XR1
Gene ID 79718
Regulator Type Protein coding
Uniprot ID Q9BZK7
Sequence
MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYV
EAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQ
QGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPV
SDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLL
ATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA
KQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPT
GNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSY
RGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK

    Click to Show/Hide
Family WD repeat EBI family
Function
F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of the N-Cor corepressor complex that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of N-Cor complex, thereby allowing cofactor exchange, and transcription activation.

    Click to Show/Hide
HGNC ID
HGNC:29529
KEGG ID hsa:79718
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TBL1XR1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
hTCs (Human tumour cells)
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
GLC-82 cells Endocervical adenocarcinoma Homo sapiens CVCL_3371
SPC-A1 cells Endocervical adenocarcinoma Homo sapiens CVCL_6955
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
In Vivo Model
BALB/c mice (male, 6 weeks old, 20-22 g) were obtained from Vital River Laboratories (Beijing, China). Immunodeficient mice were randomly divided into groups (n = 6 per group). A549 cells (1 x 106) were injected subcutaneously into the dorsal left flank of nude mice. In each group, mice (20-25 g) were administered 100 uL of the nanomedicine working solution through the tail vein, once every 3 days.

    Click to Show/Hide
Response regulation The expression level of miR-101-3p negatively correlated with clinical tumour size and TNM stage. miR-101-3p restores ferroptosis in lung cancer cells by directly targeting TBLR1, which in turn promotes apoptosis and inhibits proliferation.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator F-box-like/WD repeat-containing protein TBL1XR1 (TBL1XR1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
hTCs (Human tumour cells)
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
GLC-82 cells Endocervical adenocarcinoma Homo sapiens CVCL_3371
SPC-A1 cells Endocervical adenocarcinoma Homo sapiens CVCL_6955
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
In Vivo Model
BALB/c mice (male, 6 weeks old, 20-22 g) were obtained from Vital River Laboratories (Beijing, China). Immunodeficient mice were randomly divided into groups (n = 6 per group). A549 cells (1 x 106) were injected subcutaneously into the dorsal left flank of nude mice. In each group, mice (20-25 g) were administered 100 uL of the nanomedicine working solution through the tail vein, once every 3 days.

    Click to Show/Hide
Response regulation The expression level of miR-101-3p negatively correlated with clinical tumour size and TNM stage. miR-101-3p restores ferroptosis in lung cancer cells by directly targeting TBLR1, which in turn promotes apoptosis and inhibits proliferation.
References
Ref 1 Nanomedicine promotes ferroptosis to inhibit tumour proliferation in vivo. Redox Biol. 2021 Jun;42:101908. doi: 10.1016/j.redox.2021.101908. Epub 2021 Feb 20.