Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10406)
Regulator Name ATP-binding cassette sub-family B member 6 (ABCB6)
Synonyms
MTABC3; PRP; UMAT; ABC-type heme transporter ABCB6; Mitochondrial ABC transporter 3; P-glycoprotein-related protein; Ubiquitously-expressed mammalian ABC half transporter
    Click to Show/Hide
Gene Name ABCB6
Gene ID 10058
Regulator Type Protein coding
Uniprot ID Q9NP58
Sequence
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPCRRRERPAGAD
SLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARGAPLPSYLLLASVLESLAGAC
GLWLLVVERSQARQRLAMGIWIKFRHSPGLLLLWTVAFAAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFVLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWR
DFGRKLRLLSGYLWPRGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIFSHLHELSLRW
HLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLTLTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI
IKYQGLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQL
YMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQA
SLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQV
GERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIV
VAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTM
ER

    Click to Show/Hide
Family ABCB family
Function
ATP-dependent transporter that catalyzes the transport of a broad-spectrum of porphyrins from the cytoplasm to the extracellular space through the plasma membrane or into the vesicle lumen. May also function as an ATP-dependent importer of porphyrins from the cytoplasm into the mitochondria, in turn may participate in the de novo heme biosynthesis regulation and in the coordination of heme and iron homeostasis during phenylhydrazine stress. May also play a key role in the early steps of melanogenesis producing PMEL amyloid fibrils. In vitro, it confers to cells a resistance to toxic metal such as arsenic and cadmium and against chemotherapeutics agent such as 5-fluorouracil, SN-38 and vincristin. In addition may play a role in the transition metal homeostasis.

    Click to Show/Hide
HGNC ID
HGNC:47
KEGG ID hsa:10058
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ABCB6 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Multiple myeloma ICD-11: 2A83
 Disease Info 
Responsed Drug Nitidine chloride Investigative
 Drug Info 
Pathway Response PI3K-Akt signaling pathway hsa04151
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 U266B1 cells Plasma cell myeloma Homo sapiens CVCL_0566
RPMI-8226 cells Plasma cell myeloma Homo sapiens CVCL_0014
Sp2/0-Ag14 cells Plasma cell myeloma Mus musculus CVCL_2199
In Vivo Model
Male BALB/c nude mice, aged 5 weeks, were procured from Guangzhou Ruige biology Model Animal Research Center (No. 44827200001656, Guangzhou, China). Tumor xenograft assay was performed by dissolving SP2/0 cells in PBS (1 x 106/200 uL) and subcutaneously inoculating them into the right flank of mice. After the tumor reached 50 mm3, the tumor-bearing mice were randomly separated into three groups and intraperitoneally administered with NC (4.6 or 6 mg/kg) every two days. Body masses and tumor sizes were determined every day. Subsequently, the mice were sacrificed, and the inhibition of tumor growth and the tumor masses were determined. Later, visceral organs and tumors from every group were harvested and immobilized in paraformaldehyde (4%). All murine experimental procedures conformed to the National Institute of Health Guide for the Care and Use of Laboratory Animals.

    Click to Show/Hide
Response regulation Mechanistically, the direct binding of Nitidine chloride (NC) to ABCB6 suppressed PI3K/AKT signaling pathway to promote ferroptosis. In conclusion, ABCB6 can be a potential therapeutic target and prognostic biomarker in Multiple myeloma (MM), while NC can be considered a novel drug for MM treatment.
Multiple myeloma [ICD-11: 2A83]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator ATP-binding cassette sub-family B member 6 (ABCB6) Protein coding
 Regulator Info 
Responsed Drug Nitidine chloride Investigative
 Drug Info 
Pathway Response PI3K-Akt signaling pathway hsa04151
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 U266B1 cells Plasma cell myeloma Homo sapiens CVCL_0566
RPMI-8226 cells Plasma cell myeloma Homo sapiens CVCL_0014
Sp2/0-Ag14 cells Plasma cell myeloma Mus musculus CVCL_2199
In Vivo Model
Male BALB/c nude mice, aged 5 weeks, were procured from Guangzhou Ruige biology Model Animal Research Center (No. 44827200001656, Guangzhou, China). Tumor xenograft assay was performed by dissolving SP2/0 cells in PBS (1 x 106/200 uL) and subcutaneously inoculating them into the right flank of mice. After the tumor reached 50 mm3, the tumor-bearing mice were randomly separated into three groups and intraperitoneally administered with NC (4.6 or 6 mg/kg) every two days. Body masses and tumor sizes were determined every day. Subsequently, the mice were sacrificed, and the inhibition of tumor growth and the tumor masses were determined. Later, visceral organs and tumors from every group were harvested and immobilized in paraformaldehyde (4%). All murine experimental procedures conformed to the National Institute of Health Guide for the Care and Use of Laboratory Animals.

    Click to Show/Hide
Response regulation Mechanistically, the direct binding of Nitidine chloride (NC) to ABCB6 suppressed PI3K/AKT signaling pathway to promote ferroptosis. In conclusion, ABCB6 can be a potential therapeutic target and prognostic biomarker in Multiple myeloma (MM), while NC can be considered a novel drug for MM treatment.
Nitidine chloride [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Multiple myeloma ICD-11: 2A83
 Disease Info 
Pathway Response PI3K-Akt signaling pathway hsa04151
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 U266B1 cells Plasma cell myeloma Homo sapiens CVCL_0566
RPMI-8226 cells Plasma cell myeloma Homo sapiens CVCL_0014
Sp2/0-Ag14 cells Plasma cell myeloma Mus musculus CVCL_2199
In Vivo Model
Male BALB/c nude mice, aged 5 weeks, were procured from Guangzhou Ruige biology Model Animal Research Center (No. 44827200001656, Guangzhou, China). Tumor xenograft assay was performed by dissolving SP2/0 cells in PBS (1 x 106/200 uL) and subcutaneously inoculating them into the right flank of mice. After the tumor reached 50 mm3, the tumor-bearing mice were randomly separated into three groups and intraperitoneally administered with NC (4.6 or 6 mg/kg) every two days. Body masses and tumor sizes were determined every day. Subsequently, the mice were sacrificed, and the inhibition of tumor growth and the tumor masses were determined. Later, visceral organs and tumors from every group were harvested and immobilized in paraformaldehyde (4%). All murine experimental procedures conformed to the National Institute of Health Guide for the Care and Use of Laboratory Animals.

    Click to Show/Hide
Response regulation Mechanistically, the direct binding of Nitidine chloride (NC) to ABCB6 suppressed PI3K/AKT signaling pathway to promote ferroptosis. In conclusion, ABCB6 can be a potential therapeutic target and prognostic biomarker in Multiple myeloma (MM), while NC can be considered a novel drug for MM treatment.
References
Ref 1 Targeting ABCB6 with nitidine chloride inhibits PI3K/AKT signaling pathway to promote ferroptosis in multiple myeloma. Free Radic Biol Med. 2023 Jul;203:86-101. doi: 10.1016/j.freeradbiomed.2023.04.003. Epub 2023 Apr 10.