Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10374)
Regulator Name Hypoxia-inducible lipid droplet-associated protein (HILPDA)
Synonyms
C7orf68, HIG2; Hypoxia-inducible gene 2 protein
    Click to Show/Hide
Gene Name HILPDA
Gene ID 29923
Regulator Type Protein coding
Uniprot ID Q9Y5L2
Sequence
MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPS
RSM

    Click to Show/Hide
Function
Increases intracellular lipid accumulation. Stimulates expression of cytokines including IL6, MIF and VEGFA. Enhances cell growth and proliferation.

    Click to Show/Hide
HGNC ID
HGNC:28859
KEGG ID hsa:29923
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
HILPDA can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Osteosarcoma ICD-11: 2B51
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
In Vitro Model
 U2OS cells Osteosarcoma Homo sapiens CVCL_0042
MNNG/HOS Cl #5 cells Osteosarcoma Homo sapiens CVCL_0439
Response regulation Both HILPDA and MUC1 were reported ferroptosis-related regulators. Interfering HILPDA and MUC1 expression would inhibit tumor cell proliferation and migration, and MUC1 might improve the ferroptosis resistance of osteosarcoma (OS) cells.
Osteosarcoma [ICD-11: 2B51]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Hypoxia-inducible lipid droplet-associated protein (HILPDA) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
In Vitro Model
 U2OS cells Osteosarcoma Homo sapiens CVCL_0042
MNNG/HOS Cl #5 cells Osteosarcoma Homo sapiens CVCL_0439
Response regulation Both HILPDA and MUC1 were reported ferroptosis-related regulators. Interfering HILPDA and MUC1 expression would inhibit tumor cell proliferation and migration, and MUC1 might improve the ferroptosis resistance of osteosarcoma (OS) cells.
References
Ref 1 A ferroptosis-related gene signature associated with immune landscape and therapeutic response in osteosarcoma. Front Oncol. 2022 Nov 11;12:1024915. doi: 10.3389/fonc.2022.1024915. eCollection 2022.