Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10373)
Regulator Name Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9)
Synonyms
TIM9, TIM9A, TIMM9A
    Click to Show/Hide
Gene Name TIMM9
Gene ID 26520
Regulator Type Protein coding
Uniprot ID Q9Y5J7
Sequence
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMT
QRISMRFQEYHIQQNEALAAKAGLLGQPR

    Click to Show/Hide
Family Small Tim family
Function
Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

    Click to Show/Hide
HGNC ID
HGNC:11819
KEGG ID hsa:26520
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TIMM9 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Intervertebral disc degeneration ICD-11: FA80
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 hNPCs (Human nucleus pulposus cells)
Response regulation Ferroptosis and immune infiltration play an important role in the pathogenesis of intervertebral disc degeneration (IDD). Seven key differentially expressed FRGs (DE-FRGs) were screened, including the upregulated genes NOX4 and PIR, and the downregulated genes TIMM9, ATF3, ENPP2, FADS2 and TFAP2A.
Intervertebral disc degeneration [ICD-11: FA80]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Mitochondrial import inner membrane translocase subunit Tim9 (TIMM9) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 hNPCs (Human nucleus pulposus cells)
Response regulation Ferroptosis and immune infiltration play an important role in the pathogenesis of intervertebral disc degeneration (IDD). Seven key differentially expressed FRGs (DE-FRGs) were screened, including the upregulated genes NOX4 and PIR, and the downregulated genes TIMM9, ATF3, ENPP2, FADS2 and TFAP2A.
References
Ref 1 Identifification and validation of ferroptosis signatures and immune infifiltration characteristics associated with intervertebral disc degeneration. Front Genet. 2023 Feb 22;14:1133615. doi: 10.3389/fgene.2023.1133615. eCollection 2023.