General Information of the Ferroptosis Regulator (ID: REG10358)
Regulator Name Ubiquitin-like-conjugating enzyme ATG3 (ATG3)
Synonyms
APG3, APG3L; Autophagy-related protein 3; Protein PC3-96
    Click to Show/Hide
Gene Name ATG3
Gene ID 64422
Regulator Type Protein coding
Uniprot ID Q9NT62
Sequence
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEE
LKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGIT
EAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVE
ACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDH
VKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAV
IPTIEYDYTRHFTM

    Click to Show/Hide
Family ATG3 family
Function
E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C- terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8- phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.

    Click to Show/Hide
HGNC ID
HGNC:20962
KEGG ID hsa:64422
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ATG3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Fibrosarcoma ICD-11: 2B53
Pathway Response Fatty acid metabolism hsa01212
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
mEFs (Mouse embryonic fibroblasts)
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Response regulation ATG13 and ATG3 are required for ferroptosis-associated lipid ROS accumulation. Ferroptosis is an autophagic cell death process, and NCOA4-mediated ferritinophagy supports ferroptosis by controlling cellular iron homeostasis in fibrosarcoma HT1080 cells.
Fibrosarcoma [ICD-11: 2B53]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Ubiquitin-like-conjugating enzyme ATG3 (ATG3) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
mEFs (Mouse embryonic fibroblasts)
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Response regulation ATG13 and ATG3 are required for ferroptosis-associated lipid ROS accumulation. Ferroptosis is an autophagic cell death process, and NCOA4-mediated ferritinophagy supports ferroptosis by controlling cellular iron homeostasis in fibrosarcoma HT1080 cells.
References
Ref 1 Ferroptosis is an autophagic cell death process. Cell Res. 2016 Sep;26(9):1021-32. doi: 10.1038/cr.2016.95. Epub 2016 Aug 12.