General Information of the Ferroptosis Regulator (ID: REG10349)
Regulator Name Charged multivesicular body protein 1a (CHMP1A)
Synonyms
Chromatin-modifying protein 1a; Vacuolar protein sorting-associated protein 46-1
    Click to Show/Hide
Gene Name CHMP1A
Gene ID 5119
Regulator Type Protein coding
Uniprot ID Q9HD42
Sequence
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGV
NWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQ
NLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSV
RSQEDQLSRRLAALRN

    Click to Show/Hide
Family SNF7 family
Function
Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. May also be involved in chromosome condensation. Targets the Polycomb group (PcG) protein BMI1/PCGF4 to regions of condensed chromatin. May play a role in stable cell cycle progression and in PcG gene silencing.

    Click to Show/Hide
HGNC ID
HGNC:8740
KEGG ID hsa:5119
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CHMP1A can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Acute kidney failure ICD-11: GB60
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
NRK-52E cells Normal Rattus norvegicus CVCL_0468
In Vivo Model
For FA-induced nephropathy mouse models, 8-week-old male wild-type and Dpep1+/- or Chmp1a+/- mice were injected with FA (250 or 200 mg/kg, dissolved in 300 mM sodium bicarbonate) intraperitoneally and euthanized on day 7. For the cisplatin-induced injury model, 8-week-old male wild-type, Dpep1+/- or Chmp1a+/- mice were injected with cisplatin (25 or 20 mg/kg) intraperitoneally.

    Click to Show/Hide
Response regulation Both Dpep1 and Chmp1a are important regulators of a single pathway, ferroptosis and lead to acute kidney injury development via altering cellular iron trafficking.
Acute kidney failure [ICD-11: GB60]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Charged multivesicular body protein 1a (CHMP1A) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
NRK-52E cells Normal Rattus norvegicus CVCL_0468
In Vivo Model
For FA-induced nephropathy mouse models, 8-week-old male wild-type and Dpep1+/- or Chmp1a+/- mice were injected with FA (250 or 200 mg/kg, dissolved in 300 mM sodium bicarbonate) intraperitoneally and euthanized on day 7. For the cisplatin-induced injury model, 8-week-old male wild-type, Dpep1+/- or Chmp1a+/- mice were injected with cisplatin (25 or 20 mg/kg) intraperitoneally.

    Click to Show/Hide
Response regulation Both Dpep1 and Chmp1a are important regulators of a single pathway, ferroptosis and lead to acute kidney injury development via altering cellular iron trafficking.
References
Ref 1 A single genetic locus controls both expression of DPEP1/CHMP1A and kidney disease development via ferroptosis. Nat Commun. 2021 Aug 23;12(1):5078. doi: 10.1038/s41467-021-25377-x.