Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10345)
Regulator Name Collectrin (CLTRN)
Synonyms
Transmembrane protein 27
    Click to Show/Hide
Gene Name CLTRN
Gene ID 57393
Regulator Type Protein coding
Uniprot ID Q9HBJ8
Sequence
MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRK
VPNREATEISHVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLND
QTLEFLKIPSTLAPPMDPSVPIWIIIFGVIFCIIIVAIALLILSGIWQRRRKNKEPSEVD
DAEDKCENMITIENGIPSDPLDMKGGHINDAFMTEDERLTPL

    Click to Show/Hide
Family CLTRN family
Function
Plays an important role in amino acid transport by acting as binding partner of amino acid transporters SLC6A18 and SLC6A19, regulating their trafficking on the cell surface and their amino acid transporter activity. May also play a role in trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Regulator of SNARE complex function. Stimulator of beta cell replication.

    Click to Show/Hide
HGNC ID
HGNC:29437
KEGG ID hsa:57393
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CLTRN can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Response regulation CLTRN acts as a target of radiation, which is regulated by the NRF1/RAN/DLD protein complex, and it enhances the radiosensitivity of hepatocellular carcinoma cells through ferroptosis.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Collectrin (CLTRN) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Response regulation CLTRN acts as a target of radiation, which is regulated by the NRF1/RAN/DLD protein complex, and it enhances the radiosensitivity of hepatocellular carcinoma cells through ferroptosis.
References
Ref 1 CLTRN, Regulated by NRF1/RAN/DLD Protein Complex, Enhances Radiation Sensitivity of Hepatocellular Carcinoma Cells Through Ferroptosis Pathway. Int J Radiat Oncol Biol Phys. 2021 Jul 1;110(3):859-871. doi: 10.1016/j.ijrobp.2020.12.062. Epub 2021 Jan 27.