Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10335)
Regulator Name Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1)
Synonyms
GEC1; Early estrogen-regulated protein; GABA(A) receptor-associated protein-like 1; Glandular epithelial cell protein 1
    Click to Show/Hide
Gene Name GABARAPL1
Gene ID 23710
Regulator Type Protein coding
Uniprot ID Q9H0R8
Sequence
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

    Click to Show/Hide
Family ATG8 family
Function
Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.

    Click to Show/Hide
HGNC ID
HGNC:4068
KEGG ID hsa:23710
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
GABARAPL1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SNU-449 cells Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SK-HEP-1 cells Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
MHCC97-H cells Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
LM3 cells Malignant neoplasms Mus musculus CVCL_D269
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
PLC/PRF/5 cells Hepatocellular carcinoma Homo sapiens CVCL_0485
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
Response regulation GABARAPL1 was downregulated in hepatocellular carcinoma (HCC) tumor-repopulating cells (TRC; a type of CSLC). Its downregulation decreased the sensitivity of HCC TRC to erastin- or sorafenib-triggered ferroptosis.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SNU-449 cells Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SK-HEP-1 cells Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
MHCC97-H cells Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
LM3 cells Malignant neoplasms Mus musculus CVCL_D269
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
PLC/PRF/5 cells Hepatocellular carcinoma Homo sapiens CVCL_0485
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
Response regulation GABARAPL1 was downregulated in hepatocellular carcinoma (HCC) tumor-repopulating cells (TRC; a type of CSLC). Its downregulation decreased the sensitivity of HCC TRC to erastin- or sorafenib-triggered ferroptosis.
References
Ref 1 Loss of GABARAPL1 confers ferroptosis resistance to cancer stem-like cells in hepatocellular carcinoma. Mol Oncol. 2022 Oct;16(20):3703-3719. doi: 10.1002/1878-0261.13305. Epub 2022 Sep 5.