Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10322)
Regulator Name Calcium uptake protein 1, mitochondrial (MICU1)
Synonyms
CALC , CBARA1; Atopy-related autoantigen CALC
    Click to Show/Hide
Gene Name MICU1
Gene ID 10367
Regulator Type Protein coding
Uniprot ID Q9BPX6
Sequence
MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESP
PCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRA
YSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKK
ISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDM
EEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQ
RKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLT
FQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALF
DCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ

    Click to Show/Hide
Family MICU1 family
Function
Key regulator of mitochondrial calcium uniporter (MCU) that senses calcium level via its EF-hand domains. MICU1 and MICU2 form a disulfide-linked heterodimer that stimulates and inhibits MCU activity, depending on the concentration of calcium. MICU1 acts both as an activator or inhibitor of mitochondrial calcium uptake. Acts as a gatekeeper of MCU at low concentration of calcium, preventing channel opening. Enhances MCU opening at high calcium concentration, allowing a rapid response of mitochondria to calcium signals generated in the cytoplasm. Regulates glucose- dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake. Induces T-helper 1- mediated autoreactivity, which is accompanied by the release of IFNG.

    Click to Show/Hide
HGNC ID
HGNC:1530
KEGG ID hsa:10367
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MICU1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Thermogenesis hsa04714
Cell Process Cell ferroptosis
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
HEK293A cells Normal Homo sapiens CVCL_6910
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Response regulation MICU1 as a key regulator for lipid peroxidation and subsequent ferroptosis under cold stress, suggesting that MICU1 can be a potential target for preventing lung adenocarcinoma cell death in organ preservation.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Calcium uptake protein 1, mitochondrial (MICU1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Thermogenesis hsa04714
Cell Process Cell ferroptosis
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
HEK293A cells Normal Homo sapiens CVCL_6910
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Response regulation MICU1 as a key regulator for lipid peroxidation and subsequent ferroptosis under cold stress, suggesting that MICU1 can be a potential target for preventing lung adenocarcinoma cell death in organ preservation.
References
Ref 1 The mitochondrial Ca(2+) uptake regulator, MICU1, is involved in cold stress-induced ferroptosis. EMBO Rep. 2021 May 5;22(5):e51532. doi: 10.15252/embr.202051532. Epub 2021 Apr 6.