General Information of the Ferroptosis Regulator (ID: REG10314)
Regulator Name Mitogen-activated protein kinase kinase kinase 14 (MAP3K14)
Synonyms
NF-kappa-beta-inducing kinase
    Click to Show/Hide
Gene Name MAP3K14
Gene ID 9020
Regulator Type Protein coding
Uniprot ID Q99558
Sequence
MAVMEMACPGAPGSAVGQQKELPKAKEKTPPLGKKQSSVYKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKRRSKARKKRKKKSSKSLAHAGVALAKPLPRTPEQESCTIPVQE
DESPLGAPYVRNTPQFTKPLKEPGLGQLCFKQLGEGLRPALPRSELHKLISPLQCLNHVW
KLHHPQDGGPLPLPTHPFPYSRLPHPFPFHPLQPWKPHPLESFLGKLACVDSQKPLPDPH
LSKLACVDSPKPLPGPHLEPSCLSRGAHEKFSVEEYLVHALQGSVSSGQAHSLTSLAKTW
AARGSRSREPSPKTEDNEGVLLTEKLKPVDYEYREEVHWATHQLRLGRGSFGEVHRMEDK
QTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQL
VKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRALQQVGG
LKSPWRGEYKEPRHPPPNQANYHQTLHAQPRELSPRAPGPRPAEETTGRAPKLQPPLPPE
PPEPNKSPPLTLSKEESGMWEPLPLSSLEPAPARNPSSPERKATVPEQELQQLEIELFLN
SLSQPFSLEEQEQILSCLSIDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSS
SWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFS
LVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP

    Click to Show/Hide
Family STE Ser/Thr protein kinase family
Function
Lymphotoxin beta-activated kinase which seems to be exclusively involved in the activation of NF-kappa-B and its transcriptional activity. Promotes proteolytic processing of NFKB2/P100, which leads to activation of NF-kappa-B via the non- canonical pathway. Could act in a receptor-selective manner.

    Click to Show/Hide
HGNC ID
HGNC:6853
KEGG ID hsa:9020
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MAP3K14 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Intervertebral disc degeneration ICD-11: FA80
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
NF-kappa B signaling pathway hsa04064
Cell Process Cell ferroptosis
In Vitro Model
hCEPs (Human cartilage endplate cells)
In Vivo Model
24 male C57BL/6J mice (8 weeks, weighing 20 ± 2 g) were purchased from Charles River (Beijing, China). Mice were anesthetized via an intraperitoneal injection of 3% pentobarbital sodium (40 mg/kg). Afterward, their extraperitoneal space was isolated and the exterior part of IVD was exposed. A 26 G puncture needle (90% of intervertebral space height) was utilized to punch in the C6/C7 IVD at a depth of 2.5 mm. The puncture needle was inserted into the dorsal annulus fibrosus across the center of the nucleus pulposus and partially across the ventral annulus fibrosus and withdrawn 30 s later.

    Click to Show/Hide
Response regulation In Intervertebral disc degeneration (IVDD) cell models, EGR1 knockdown reduced ferroptosis and cartilage degeneration, which was reversed by MAP3K14 overexpression or Erastin treatment. Collectively, EGR1 promoted ferroptosis and IVD cartilage degeneration through MAP3K14-NF-B axis.
Intervertebral disc degeneration [ICD-11: FA80]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Mitogen-activated protein kinase kinase kinase 14 (MAP3K14) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
NF-kappa B signaling pathway hsa04064
Cell Process Cell ferroptosis
In Vitro Model
hCEPs (Human cartilage endplate cells)
In Vivo Model
24 male C57BL/6J mice (8 weeks, weighing 20 ± 2 g) were purchased from Charles River (Beijing, China). Mice were anesthetized via an intraperitoneal injection of 3% pentobarbital sodium (40 mg/kg). Afterward, their extraperitoneal space was isolated and the exterior part of IVD was exposed. A 26 G puncture needle (90% of intervertebral space height) was utilized to punch in the C6/C7 IVD at a depth of 2.5 mm. The puncture needle was inserted into the dorsal annulus fibrosus across the center of the nucleus pulposus and partially across the ventral annulus fibrosus and withdrawn 30 s later.

    Click to Show/Hide
Response regulation In Intervertebral disc degeneration (IVDD) cell models, EGR1 knockdown reduced ferroptosis and cartilage degeneration, which was reversed by MAP3K14 overexpression or Erastin treatment. Collectively, EGR1 promoted ferroptosis and IVD cartilage degeneration through MAP3K14-NF-B axis.
References
Ref 1 EGR1 knockdown confers protection against ferroptosis and ameliorates intervertebral disc cartilage degeneration by inactivating the MAP3K14/NF-B axis. Genomics. 2023 Jul 13;115(5):110683. doi: 10.1016/j.ygeno.2023.110683. Online ahead of print.