Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10286)
Regulator Name Cytoglobin (CYGB)
Synonyms
STAP; Histoglobin; Stellate cell activation-associated protein
    Click to Show/Hide
Gene Name CYGB
Gene ID 114757
Regulator Type Protein coding
Uniprot ID Q8WWM9
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP

    Click to Show/Hide
Family Globin family
Function
May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.

    Click to Show/Hide
HGNC ID
HGNC:16505
KEGG ID hsa:114757
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CYGB can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Colon cancer ICD-11: 2B90
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
Response regulation CYGB significantly increased the sensitivity of cancer cells to RSL3- and erastin-induced ferroptotic cell death. Collectively, a novel tumour suppressor role of CYGB through p53-YAP1 axis in regulating ferroptosis and suggested a potential therapeutic approach for colon cancer.
Colon cancer [ICD-11: 2B90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Cytoglobin (CYGB) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
Response regulation CYGB significantly increased the sensitivity of cancer cells to RSL3- and erastin-induced ferroptotic cell death. Collectively, a novel tumour suppressor role of CYGB through p53-YAP1 axis in regulating ferroptosis and suggested a potential therapeutic approach for colon cancer.
References
Ref 1 Cytoglobin promotes sensitivity to ferroptosis by regulating p53-YAP1 axis in colon cancer cells. J Cell Mol Med. 2021 Apr;25(7):3300-3311. doi: 10.1111/jcmm.16400. Epub 2021 Feb 21.