Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10285)
Regulator Name Fatty acyl-CoA reductase 1 (FAR1)
Synonyms
Male sterility domain-containing protein 2
    Click to Show/Hide
Gene Name FAR1
Gene ID 84188
Regulator Type Protein coding
Uniprot ID Q8WVX9
Sequence
MVSIPEYYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVL
SGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNEN
LRDAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDS
LEWMDDGLVNDITPKLIGDRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPF
PGWIDNFNGPSGLFIAAGKGILRTIRASNNALADLVPVDVVVNMSLAAAWYSGVNRPRNI
MVYNCTTGSTNPFHWGEVEYHVISTFKRNPLEQAFRRPNVNLTSNHLLYHYWIAVSHKAP
AFLYDIYLRMTGRSPRMMKTITRLHKAMVFLEYFTSNSWVWNTENVNMLMNQLNPEDKKT
FNIDVRQLHWAEYIENYCLGTKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVILIWR
IFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY

    Click to Show/Hide
Family Fatty acyl-CoA reductase family
Function
Catalyzes the reduction of saturated and unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols. It plays an essential role in the production of ether lipids/plasmalogens which synthesis requires fatty alcohols. In parallel, it is also required for wax monoesters production since fatty alcohols also constitute a substrate for their synthesis.

    Click to Show/Hide
HGNC ID
HGNC:26222
KEGG ID hsa:84188
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
FAR1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Ischemia/reperfusion injury ICD-11: DB98
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
U-87MG cells Glioblastoma Homo sapiens CVCL_GP63
A2780 cells Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
HO8910 cells Endocervical adenocarcinoma Homo sapiens CVCL_6868
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HuH-6 cells Hepatoblastoma Homo sapiens CVCL_4381
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Li-7 cells Adult hepatocellular carcinoma Homo sapiens CVCL_3840
In Vivo Model
8-week old female mice were purchased from Charles River Laboratories and prepared for the establishment of kidney ischemia/reperfusion. The mice were randomly distributed and anaesthetized with subcutaneous injection of sodium pentobarbital (30 mg/kg, Sigma). The heating pads were used to maintain the body temperature. Via the abdominal approach, the bilateral renal pedicles were clamped for 30 min by using a vascular clamp. Then the clamp was removed and the abdominal cavity was closed using sutures. For the group of ferrostatin-1 treatment, mice were injected intraperitoneally 200 ul PBS containing 5 mg/kg ferrostatin-1 30 min before ischemia.

    Click to Show/Hide
Response regulation FAR1 expression is positively correlated with the process of ferroptosis in renal ischemia reperfusion injury (IRI) and tumors. TMEM189, a newly identified gene which introduces vinyl-ether double bond into alkyl-ether lipids to generate plasmalogens abrogates FAR1-alkyl-ether lipids axis induced ferroptosis.
Ischemia/reperfusion injury [ICD-11: DB98]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Fatty acyl-CoA reductase 1 (FAR1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
U-87MG cells Glioblastoma Homo sapiens CVCL_GP63
A2780 cells Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
HO8910 cells Endocervical adenocarcinoma Homo sapiens CVCL_6868
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
HuH-6 cells Hepatoblastoma Homo sapiens CVCL_4381
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Li-7 cells Adult hepatocellular carcinoma Homo sapiens CVCL_3840
In Vivo Model
8-week old female mice were purchased from Charles River Laboratories and prepared for the establishment of kidney ischemia/reperfusion. The mice were randomly distributed and anaesthetized with subcutaneous injection of sodium pentobarbital (30 mg/kg, Sigma). The heating pads were used to maintain the body temperature. Via the abdominal approach, the bilateral renal pedicles were clamped for 30 min by using a vascular clamp. Then the clamp was removed and the abdominal cavity was closed using sutures. For the group of ferrostatin-1 treatment, mice were injected intraperitoneally 200 ul PBS containing 5 mg/kg ferrostatin-1 30 min before ischemia.

    Click to Show/Hide
Response regulation FAR1 expression is positively correlated with the process of ferroptosis in renal ischemia reperfusion injury (IRI) and tumors. TMEM189, a newly identified gene which introduces vinyl-ether double bond into alkyl-ether lipids to generate plasmalogens abrogates FAR1-alkyl-ether lipids axis induced ferroptosis.
References
Ref 1 Peroxisome-driven ether-linked phospholipids biosynthesis is essential for ferroptosis. Cell Death Differ. 2021 Aug;28(8):2536-2551. doi: 10.1038/s41418-021-00769-0. Epub 2021 Mar 17.