Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10282)
Regulator Name RB1-inducible coiled-coil protein 1 (RB1CC1)
Synonyms
KIAA0203, RBICC; FAK family kinase-interacting protein of 200 kDa
    Click to Show/Hide
Gene Name RB1CC1
Gene ID 9821
Regulator Type Protein coding
Uniprot ID Q8TDY2
Sequence
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTEL
VLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGD
LPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMK
AIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQL
MIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELL
ERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGK
LFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVP
LLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTA
GITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLD
LDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDT
NVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCT
AVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELV
CLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLE
DLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKE
NQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEE
SRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISEL
ISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQ
QEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKEL
LEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNV
RTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLE
EKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMET
SMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRD
FQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVM
EKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

    Click to Show/Hide
Family ATG17 family
Function
Involved in autophagy. Regulates early events but also late events of autophagosome formation through direct interaction with Atg16L1. Required for the formation of the autophagosome-like double-membrane structure that surrounds the Salmonella-containing vacuole (SCV) during S.typhimurium infection and subsequent xenophagy. Involved in repair of DNA damage caused by ionizing radiation, which subsequently improves cell survival by decreasing apoptosis. Inhibits PTK2/FAK1 and PTK2B/PYK2 kinase activity, affecting their downstream signaling pathways. Plays a role as a modulator of TGF-beta-signaling by restricting substrate specificity of RNF111. Functions as a DNA-binding transcription factor. Is a potent regulator of the RB1 pathway through induction of RB1 expression. Plays a crucial role in muscular differentiation. Plays an indispensable role in fetal hematopoiesis and in the regulation of neuronal homeostasis.

    Click to Show/Hide
HGNC ID
HGNC:15574
KEGG ID hsa:9821
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
RB1CC1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H226 cells Pleural epithelioid mesothelioma Homo sapiens CVCL_1544
SW1990 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1723
BEL-7402 cells Endocervical adenocarcinoma Homo sapiens CVCL_5492
HT-29 cells Colon adenocarcinoma Homo sapiens CVCL_0320
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
Calu-1 cells Lung squamous cell carcinoma Homo sapiens CVCL_0608
HEK-293T cells Normal Homo sapiens CVCL_0063
143B cells Osteosarcoma Homo sapiens CVCL_2270
In Vivo Model
To evaluate the effects of drugs to strengthen the effects of IKE, cell-derived xenograft (CDX) mouse models were generated by subcutaneously injecting 2 x 106 cells per athymic nude mouse (BALB/c-nu, Spaefer, Beijing, China). When tumours were 220-250 mm3, mice were administered with IKE (50 mg/kg) daily with or without PTX (20 mg/kg), Clolar (10 mg/kg), OXA (10 mg/kg) or TMZ (40 mg/kg). Tumour growth was monitored, and sizes were calculated by 0.5 x L x W2 (L indicating length and W indicating width).

    Click to Show/Hide
Response regulation Nuclear localisation of RB1CC1 correlated with lipid peroxidation in clinical lung cancer specimens. Rb1cc1 was essential for ferroptosis agonists to suppress liver tumourigenesis in mice.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator RB1-inducible coiled-coil protein 1 (RB1CC1) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H226 cells Pleural epithelioid mesothelioma Homo sapiens CVCL_1544
SW1990 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1723
BEL-7402 cells Endocervical adenocarcinoma Homo sapiens CVCL_5492
HT-29 cells Colon adenocarcinoma Homo sapiens CVCL_0320
NCI-H460 cells Lung large cell carcinoma Homo sapiens CVCL_0459
Calu-1 cells Lung squamous cell carcinoma Homo sapiens CVCL_0608
HEK-293T cells Normal Homo sapiens CVCL_0063
143B cells Osteosarcoma Homo sapiens CVCL_2270
In Vivo Model
To evaluate the effects of drugs to strengthen the effects of IKE, cell-derived xenograft (CDX) mouse models were generated by subcutaneously injecting 2 x 106 cells per athymic nude mouse (BALB/c-nu, Spaefer, Beijing, China). When tumours were 220-250 mm3, mice were administered with IKE (50 mg/kg) daily with or without PTX (20 mg/kg), Clolar (10 mg/kg), OXA (10 mg/kg) or TMZ (40 mg/kg). Tumour growth was monitored, and sizes were calculated by 0.5 x L x W2 (L indicating length and W indicating width).

    Click to Show/Hide
Response regulation Nuclear localisation of RB1CC1 correlated with lipid peroxidation in clinical lung cancer specimens. Rb1cc1 was essential for ferroptosis agonists to suppress liver tumourigenesis in mice.
References
Ref 1 Tumour cells are sensitised to ferroptosis via RB1CC1-mediated transcriptional reprogramming. Clin Transl Med. 2022 Feb;12(2):e747. doi: 10.1002/ctm2.747.