Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10268)
Regulator Name Prominin-2 (PROM2)
Synonyms
PROML2; Prominin-like protein 2
    Click to Show/Hide
Gene Name PROM2
Gene ID 150696
Regulator Type Protein coding
Uniprot ID Q8N271
Sequence
MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLL
DSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLV
PTAGLCFCCCRCHRRCGGRVKTEHKALACERAALMVFLLLTTLLLLIGVVCAFVTNQRTH
EQMGPSIEAMPETLLSLWGLVSDVPQELQAVAQQFSLPQEQVSEELDGVGVSIGSAIHTQ
LRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQQDLEPAIREHRDRLLELLQE
ARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQEENSTFNALPA
LAAMQTSSVVQELKKAVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQR
YETYRWIVGCVLCSVVLFVVLCNLLGLNLGIWGLSARDDPSHPEAKGEAGARFLMAGVGL
SFLFAAPLILLVFATFLVGGNVQTLVCQSWENGELFEFADTPGNLPPSMNLSQLLGLRKN
ISIHQAYQQCKEGAALWTVLQLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSS
AARRDLEALQSSGLQRIHYPDFLVQIQRPVVKTSMEQLAQELQGLAQAQDNSVLGQRLQE
EAQGLRNLHQEKVVPQQSLVAKLNLSVRALESSAPNLQLETSDVLANVTYLKGELPAWAA
RILRNVSECFLAREMGYFSQYVAWVREEVTQRIATCQPLSGALDNSRVILCDMMADPWNA
FWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL

    Click to Show/Hide
Family Prominin family
HGNC ID
HGNC:20685
KEGG ID hsa:150696
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PROM2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 2 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 MCF-10A cells Normal Homo sapiens CVCL_0598
Hs-578T cells Invasive breast carcinoma Homo sapiens CVCL_0332
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
Response regulation Prominin2 (PROM2) facilitates ferroptosis resistance in mammary epithelial and breast cancer cells. Mechanistically, prominin2 promotes the formation of ferritin-containing multivesicular bodies (MVBs) and exosomes that transport iron out of the cell, inhibiting ferroptosis.
Experiment 2 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Bladder cancer ICD-11: 2C94
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell invasion
In Vitro Model
 5637 cells Bladder carcinoma Homo sapiens CVCL_0126
T24 cells Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 cells Normal Homo sapiens CVCL_3798
In Vivo Model
The male nude mice (BALB/c, aged 4-6 weeks, 18-20 g) were randomly divided into four groups (Sample size: 5-7 mice per group) and inoculated with cells as follows: sh-RP11-89 stable transfected 5637 Cell (1 x 107 cells); shNC-RP11-89 stable transfected 5637 Cell (1 x 107 cells); sh-RP11-89 stable transfected 5637 Cell + antagomiR-129-5p (1 x 107 cells; 10 nmol antagomiR-129-5p injection/mouse, 3 days after tumor formation); and sh-RP11-89 stable transfected 5637 Cell + miR-129-5p NC group (1 x 107 cells; 10 nmol miR-129-5p NC injection/mouse, 3 days after tumor formation). Cells were mixed with matrigel (1:2) and inoculated subcutaneously at the right rear back region.

    Click to Show/Hide
Response regulation RP11-89 "sponges" miR-129-5p and upregulates PROM2. RP11-89 promoted cell proliferation, migration and tumorigenesis and inhibited cell cycle arrest via the miR-129-5p/PROM2 axis. RP11-89 may serve as a potential biomarker for targeted therapy in bladder cancer.
Breast cancer [ICD-11: 2C60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Prominin-2 (PROM2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 MCF-10A cells Normal Homo sapiens CVCL_0598
Hs-578T cells Invasive breast carcinoma Homo sapiens CVCL_0332
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
Response regulation Prominin2 (PROM2) facilitates ferroptosis resistance in mammary epithelial and breast cancer cells. Mechanistically, prominin2 promotes the formation of ferritin-containing multivesicular bodies (MVBs) and exosomes that transport iron out of the cell, inhibiting ferroptosis.
Bladder cancer [ICD-11: 2C94]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Prominin-2 (PROM2) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell invasion
In Vitro Model
 5637 cells Bladder carcinoma Homo sapiens CVCL_0126
T24 cells Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 cells Normal Homo sapiens CVCL_3798
In Vivo Model
The male nude mice (BALB/c, aged 4-6 weeks, 18-20 g) were randomly divided into four groups (Sample size: 5-7 mice per group) and inoculated with cells as follows: sh-RP11-89 stable transfected 5637 Cell (1 x 107 cells); shNC-RP11-89 stable transfected 5637 Cell (1 x 107 cells); sh-RP11-89 stable transfected 5637 Cell + antagomiR-129-5p (1 x 107 cells; 10 nmol antagomiR-129-5p injection/mouse, 3 days after tumor formation); and sh-RP11-89 stable transfected 5637 Cell + miR-129-5p NC group (1 x 107 cells; 10 nmol miR-129-5p NC injection/mouse, 3 days after tumor formation). Cells were mixed with matrigel (1:2) and inoculated subcutaneously at the right rear back region.

    Click to Show/Hide
Response regulation RP11-89 "sponges" miR-129-5p and upregulates PROM2. RP11-89 promoted cell proliferation, migration and tumorigenesis and inhibited cell cycle arrest via the miR-129-5p/PROM2 axis. RP11-89 may serve as a potential biomarker for targeted therapy in bladder cancer.
References
Ref 1 Prominin2 Drives Ferroptosis Resistance by Stimulating Iron Export. Dev Cell. 2019 Dec 2;51(5):575-586.e4. doi: 10.1016/j.devcel.2019.10.007. Epub 2019 Nov 14.
Ref 2 LncRNA RP11-89 facilitates tumorigenesis and ferroptosis resistance through PROM2-activated iron export by sponging miR-129-5p in bladder cancer. Cell Death Dis. 2021 Nov 2;12(11):1043. doi: 10.1038/s41419-021-04296-1.