Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10254)
Regulator Name Ethanolaminephosphotransferase 1 (Selenoi)
Synonyms
Selenoprotein I
    Click to Show/Hide
Gene Name Selenoi
Gene ID 28042
Regulator Type Protein coding
Uniprot ID Q80TA1
Sequence
MAGYEYVSPEQLSGFDKYKYSALDTNPLSLYIMHPFWNTIVKVFPTWLAPNLITFSGFML
LVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFAAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWSCVYFVVTVYSIFGRGPTGVSVFVLYLLLWVVLFSFILSHWEKYNTGVL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLL
NFFRSYKSNTLKHKSVYEAMVPFFSPCLLFTLCTVWILWSPSDILEIHPRIFYFMVGTAF
ANITCQLIVCQMSSTRCPTLNWLLLPLLLVVAAVIVGAATSRLESALLYTLTAAFTLAHI
HYGVQVVKQLSRHFQIYPFSLRKPNSDULGMEEQNIGL

    Click to Show/Hide
Family CDP-alcohol phosphatidyltransferase class-I family
Function
Ethanolaminephosphotransferase that catalyzes the transfer of phosphoethanolamine/PE from CDP-ethanolamine to lipid acceptors, the final step in the synthesis of PE via the 'Kennedy' pathway. PE is the second most abundant phospholipid of membranes in mammals and is involved in various membrane-related cellular processes. The enzyme is critical for the synthesis of several PE species and could also catalyze the synthesis of ether-linked phospholipids like plasmanyl- and plasmenyl-PE which could explain it is required for proper myelination and neurodevelopment.

    Click to Show/Hide
KEGG ID mmu:28042
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
Selenoi can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Health ICD-11: N.A.
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Response regulation EPT1, also termed selenoprotein I (SELENOI), is speculated to directly synthesize phosphatidylethanolamine that drives ferroptosis. It also plays an indispensable role in myelination, neural development and maintaining phospholipid homeostasis in humans. This is consistent with our hypothesis that lowEPT1expression could induce AD through ferroptosis.
Health [ICD-11: N.A.]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Ethanolaminephosphotransferase 1 (Selenoi) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Response regulation EPT1, also termed selenoprotein I (SELENOI), is speculated to directly synthesize phosphatidylethanolamine that drives ferroptosis. It also plays an indispensable role in myelination, neural development and maintaining phospholipid homeostasis in humans. This is consistent with our hypothesis that lowEPT1expression could induce AD through ferroptosis.
References
Ref 1 lncRNA-associated ceRNA network revealing the potential regulatory roles of ferroptosis and immune infiltration in Alzheimer's disease. Front Aging Neurosci. 2023 Feb 16;15:1105690. doi: 10.3389/fnagi.2023.1105690. eCollection 2023.