General Information of the Ferroptosis Regulator (ID: REG10244)
Regulator Name WD repeat domain phosphoinositide-interacting protein 1 (WIPI1)
Synonyms
WIPI49; Atg18 protein homolog; WD40 repeat protein interacting with phosphoinositides of 49 kDa
    Click to Show/Hide
Gene Name WIPI1
Gene ID 55062
Regulator Type Protein coding
Uniprot ID Q5MNZ9
Sequence
MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS

    Click to Show/Hide
Family WD repeat PROPPIN family
Function
Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation. Plays an important role in starvation- and calcium-mediated autophagy, as well as in mitophagy. Functions downstream of the ULK1 and PI3- kinases that produce phosphatidylinositol 3-phosphate (PtdIns3P) on membranes of the endoplasmic reticulum once activated. Binds phosphatidylinositol 3-phosphate (PtdIns3P), and maybe other phosphoinositides including PtdIns3,5P2 and PtdIns5P, and is recruited to phagophore assembly sites at the endoplasmic reticulum membranes. There, it assists WIPI2 in the recruitment of ATG12- ATG5-ATG16L1, a complex that directly controls the elongation of the nascent autophagosomal membrane. Together with WDR45/WIPI4, promotes ATG2 (ATG2A or ATG2B)-mediated lipid transfer by enhancing ATG2-association with phosphatidylinositol 3-monophosphate (PI3P)-containing membranes. Involved in xenophagy of Staphylococcus aureus. Invading S.aureus cells become entrapped in autophagosome-like WIPI1 positive vesicles targeted for lysosomal degradation. Also plays a distinct role in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation-induced autophagy. May also regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway.

    Click to Show/Hide
HGNC ID
HGNC:25471
KEGG ID hsa:55062
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
WIPI1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Sepsis ICD-11: 1G40
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vivo Model
Beijing Vital River Laboratory Animal Technology Co. Ltd. provided 20 specific pathogen-free female C57BL/6J mice (8-10 weeks old, weighing 20-22g). All procedures on mice were performed under sodium pentobarbital anesthesia, and all efforts were made to minimize suffering. 12 h after surgery, the blood was collected from orbital sinus.

    Click to Show/Hide
Response regulation 3 FRDEGs (TLR4, WIPI1, and GABARAPL2), with high sensitivity and specificity in sepsis diagnosis, were selected for construction of prognostic risk signature. The expression of genes in risk signature was also validated in CLP mouse model via qRT-PCR.
Sepsis [ICD-11: 1G40]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator WD repeat domain phosphoinositide-interacting protein 1 (WIPI1) Protein coding
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vivo Model
Beijing Vital River Laboratory Animal Technology Co. Ltd. provided 20 specific pathogen-free female C57BL/6J mice (8-10 weeks old, weighing 20-22g). All procedures on mice were performed under sodium pentobarbital anesthesia, and all efforts were made to minimize suffering. 12 h after surgery, the blood was collected from orbital sinus.

    Click to Show/Hide
Response regulation 3 FRDEGs (TLR4, WIPI1, and GABARAPL2), with high sensitivity and specificity in sepsis diagnosis, were selected for construction of prognostic risk signature. The expression of genes in risk signature was also validated in CLP mouse model via qRT-PCR.
References
Ref 1 Identification of a Ferroptosis-Related Prognostic Signature in Sepsis via Bioinformatics Analyses and Experiment Validation. Biomed Res Int. 2022 May 25;2022:8178782. doi: 10.1155/2022/8178782. eCollection 2022.