Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10235)
Regulator Name Discoidin domain-containing receptor 2 (DDR2)
Synonyms
NTRKR3, TKT, TYRO10; CD167 antigen-like family member B; Discoidin domain-containing receptor tyrosine kinase 2; Neurotrophic tyrosine kinase, receptor-related 3; Receptor protein-tyrosine kinase TKT; Tyrosine-protein kinase TYRO10; CD_antigen=CD167b
    Click to Show/Hide
Gene Name DDR2
Gene ID 4921
Regulator Type Protein coding
Uniprot ID Q16832
Sequence
MILIPRMLLVLFLLLPILSSAKAQVNPAICRYPLGMSGGQIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKI
NYSRDGTRWISWRNRHGKQVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRV
ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD
DFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK
EVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS
EITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL
WRQFWQKMLEKASRRMLDDEMTVSLSLPSDSSMFNNNRSSSPSEQGSNSTYDRIFPLRPD
YQEPSRLIRKLPEFAPGEEESGCSGVVKPVQPSGPEGVPHYAEADIVNLQGVTGGNTYSV
PAVTMDLLSGKDVAVEEFPRKLLTFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN
QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIHLLAVCITDDPLCMITEYMENG
DLNQFLSRHEPPNSSSSDVRTVSYTNLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGK
NYTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWET
FTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRP
SFQEIHLLLLQQGDE

    Click to Show/Hide
Family Tyr protein kinase family
Function
Tyrosine kinase involved in the regulation of tissues remodeling. It functions as cell surface receptor for fibrillar collagen and regulates cell differentiation, remodeling of the extracellular matrix, cell migration and cell proliferation. Required for normal bone development. Regulates osteoblast differentiation and chondrocyte maturation via a signaling pathway that involves MAP kinases and leads to the activation of the transcription factor RUNX2. Regulates remodeling of the extracellular matrix by up- regulation of the collagenases MMP1, MMP2 and MMP13, and thereby facilitates cell migration and tumor cell invasion. Promotes fibroblast migration and proliferation, and thereby contributes to cutaneous wound healing.

    Click to Show/Hide
HGNC ID
HGNC:2731
KEGG ID hsa:4921
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
DDR2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell adhesion molecules hsa04514
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SUM52PE cells Breast carcinoma Homo sapiens CVCL_3425
ZR-75-1 cells Invasive breast carcinoma Homo sapiens CVCL_0588
BT-474 cells Invasive breast carcinoma Homo sapiens CVCL_0179
MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
BT-20 cells Invasive breast carcinoma of no special type Homo sapiens CVCL_0178
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
Hs-578T cells Invasive breast carcinoma Homo sapiens CVCL_0332
MDA-MB-157 cells Breast carcinoma Homo sapiens CVCL_0618
BT-549 cells Invasive breast carcinoma Homo sapiens CVCL_1092
Response regulation Discoidin Domain Receptor Tyrosine Kinase 2 (DDR2), the receptor for collagen I, is highly expressed in ferroptosis-sensitive recurrent tumor cells and human mesenchymal breast cancer cells. Erastin treatment induces DDR2 upregulation and phosphorylation, independent of collagen I. Furthermore, DDR2 knockdown in recurrent tumor cells reduces clonogenic proliferation.
Breast cancer [ICD-11: 2C60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Discoidin domain-containing receptor 2 (DDR2) Protein coding
 Regulator Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell adhesion molecules hsa04514
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SUM52PE cells Breast carcinoma Homo sapiens CVCL_3425
ZR-75-1 cells Invasive breast carcinoma Homo sapiens CVCL_0588
BT-474 cells Invasive breast carcinoma Homo sapiens CVCL_0179
MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
BT-20 cells Invasive breast carcinoma of no special type Homo sapiens CVCL_0178
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
Hs-578T cells Invasive breast carcinoma Homo sapiens CVCL_0332
MDA-MB-157 cells Breast carcinoma Homo sapiens CVCL_0618
BT-549 cells Invasive breast carcinoma Homo sapiens CVCL_1092
Response regulation Discoidin Domain Receptor Tyrosine Kinase 2 (DDR2), the receptor for collagen I, is highly expressed in ferroptosis-sensitive recurrent tumor cells and human mesenchymal breast cancer cells. Erastin treatment induces DDR2 upregulation and phosphorylation, independent of collagen I. Furthermore, DDR2 knockdown in recurrent tumor cells reduces clonogenic proliferation.
Erastin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Pathway Response Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell adhesion molecules hsa04514
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SUM52PE cells Breast carcinoma Homo sapiens CVCL_3425
ZR-75-1 cells Invasive breast carcinoma Homo sapiens CVCL_0588
BT-474 cells Invasive breast carcinoma Homo sapiens CVCL_0179
MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
BT-20 cells Invasive breast carcinoma of no special type Homo sapiens CVCL_0178
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
Hs-578T cells Invasive breast carcinoma Homo sapiens CVCL_0332
MDA-MB-157 cells Breast carcinoma Homo sapiens CVCL_0618
BT-549 cells Invasive breast carcinoma Homo sapiens CVCL_1092
Response regulation Discoidin Domain Receptor Tyrosine Kinase 2 (DDR2), the receptor for collagen I, is highly expressed in ferroptosis-sensitive recurrent tumor cells and human mesenchymal breast cancer cells. Erastin treatment induces DDR2 upregulation and phosphorylation, independent of collagen I. Furthermore, DDR2 knockdown in recurrent tumor cells reduces clonogenic proliferation.
References
Ref 1 DDR2 upregulation confers ferroptosis susceptibility of recurrent breast tumors through the Hippo pathway. Oncogene. 2021 Mar;40(11):2018-2034. doi: 10.1038/s41388-021-01676-x. Epub 2021 Feb 18.