Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10223)
Regulator Name Adiponectin (ADIPOQ)
Synonyms
30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; Gelatin-binding protein
    Click to Show/Hide
Gene Name ADIPOQ
Gene ID 9370
Regulator Type Protein coding
Uniprot ID Q15848
Sequence
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN

    Click to Show/Hide
Function
Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.

    Click to Show/Hide
HGNC ID
HGNC:13633
KEGG ID hsa:9370
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ADIPOQ can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Gestational diabetes ICD-11: JA63
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HTR-8/SVneo cells Normal Homo sapiens CVCL_7162
In Vivo Model
Mice in STZ, HFD + STZ, and HFD/ADN + STZ group were intraperitoneally injected with STZ 40 mg/kg (STZ dissolved in 0.1 mol/L citric acid/sodium citrate buffer) daily for 3 consecutive days and the criteria for successful modeling of GDM were fasting blood glucose >=11.1 mmol/L or random blood glucose >=16.7 mmol/L 72 h after STZ injection.

    Click to Show/Hide
Response regulation ADPN (ADIPOQ) ameliorated placental injury in gestational diabetes (GDM) by correcting fatty acid oxidation/peroxide imbalance-induced ferroptosis via restoration of CPT-1 activity.
Gestational diabetes [ICD-11: JA63]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Adiponectin (ADIPOQ) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HTR-8/SVneo cells Normal Homo sapiens CVCL_7162
In Vivo Model
Mice in STZ, HFD + STZ, and HFD/ADN + STZ group were intraperitoneally injected with STZ 40 mg/kg (STZ dissolved in 0.1 mol/L citric acid/sodium citrate buffer) daily for 3 consecutive days and the criteria for successful modeling of GDM were fasting blood glucose >=11.1 mmol/L or random blood glucose >=16.7 mmol/L 72 h after STZ injection.

    Click to Show/Hide
Response regulation ADPN (ADIPOQ) ameliorated placental injury in gestational diabetes (GDM) by correcting fatty acid oxidation/peroxide imbalance-induced ferroptosis via restoration of CPT-1 activity.
References
Ref 1 Adiponectin ameliorates placental injury in gestational diabetes mice by correcting fatty acid oxidation/peroxide imbalance-induced ferroptosis via restoration of CPT-1 activity. Endocrine. 2022 Mar;75(3):781-793. doi: 10.1007/s12020-021-02933-5. Epub 2021 Dec 2.