Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10200)
Regulator Name Myocyte-specific enhancer factor 2C (MEF2C)
Synonyms
Myocyte enhancer factor 2C
    Click to Show/Hide
Gene Name MEF2C
Gene ID 4208
Regulator Type Protein coding
Uniprot ID Q06413
Sequence
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT

    Click to Show/Hide
Family MEF2 family
Function
Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Enhances transcriptional activation mediated by SOX18. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B-lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B-cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoforms that lack the repressor domain are more active than isoform 1.

    Click to Show/Hide
HGNC ID
HGNC:6996
KEGG ID hsa:4208
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MEF2C can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Meningiomas ICD-11: 2A01
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 CH-157MN cells Meningioma Homo sapiens CVCL_5723
IOMM-Lee cells Intracranial meningioma Homo sapiens CVCL_5779
PM3 (Human meningioma cells)
In Vivo Model
6-week-old male nude mice (Nanjing Medical University Animal Center) were used in this study. There were 6-8 mice/group for survival and tumor growth analysis experiments. For tumor growth analysis, (2 x 106) IOMM-Lee-shMEF2C, IOMM-Lee-shMEF2C-Lv-NF2 or IOMM-Lee-shMEF2C-Lv-Ecad cells were subcutaneously injected to the right flank of the mice to examine the effect of MEF2C, NF2 and E-cadherin status on ferropotosis inducing response in vivo. Erastin, 15 mg/kg in 10% DMSO, or vehicle was administrated intraperitoneally (i.p.) every other day starting at Day 5 after implantation. Tumor diameter was recorded every 5 days starting at Day 10 when the tumors were visible and detectable.

    Click to Show/Hide
Response regulation MEF2C was found to drive the expression of both NF2 and E-cadherin. NF2 loss and low E-cadherin create susceptibility to ferroptosis in meningioma. MEF2C could be a new molecular target in ferroptosis-inducing therapies for meningioma.
Meningiomas [ICD-11: 2A01]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Myocyte-specific enhancer factor 2C (MEF2C) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 CH-157MN cells Meningioma Homo sapiens CVCL_5723
IOMM-Lee cells Intracranial meningioma Homo sapiens CVCL_5779
PM3 (Human meningioma cells)
In Vivo Model
6-week-old male nude mice (Nanjing Medical University Animal Center) were used in this study. There were 6-8 mice/group for survival and tumor growth analysis experiments. For tumor growth analysis, (2 x 106) IOMM-Lee-shMEF2C, IOMM-Lee-shMEF2C-Lv-NF2 or IOMM-Lee-shMEF2C-Lv-Ecad cells were subcutaneously injected to the right flank of the mice to examine the effect of MEF2C, NF2 and E-cadherin status on ferropotosis inducing response in vivo. Erastin, 15 mg/kg in 10% DMSO, or vehicle was administrated intraperitoneally (i.p.) every other day starting at Day 5 after implantation. Tumor diameter was recorded every 5 days starting at Day 10 when the tumors were visible and detectable.

    Click to Show/Hide
Response regulation MEF2C was found to drive the expression of both NF2 and E-cadherin. NF2 loss and low E-cadherin create susceptibility to ferroptosis in meningioma. MEF2C could be a new molecular target in ferroptosis-inducing therapies for meningioma.
References
Ref 1 MEF2C silencing downregulates NF2 and E-cadherin and enhances Erastin-induced ferroptosis in meningioma. Neuro Oncol. 2021 Dec 1;23(12):2014-2027. doi: 10.1093/neuonc/noab114.