Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10197)
Regulator Name Peroxisome proliferator-activated receptor delta (PPARD)
Synonyms
NR1C2, PPARB; NUCI; Nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferator-activated receptor beta
    Click to Show/Hide
Gene Name PPARD
Gene ID 5467
Regulator Type Protein coding
Uniprot ID Q03181
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY

    Click to Show/Hide
Family Nuclear hormone receptor family
Function
Ligand-activated transcription factor key mediator of energy metabolism in adipose tissues. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma- linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.

    Click to Show/Hide
HGNC ID
HGNC:9235
KEGG ID hsa:5467
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PPARD can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Health ICD-11: N.A.
 Disease Info 
Responsed Drug GW501516 Discontinued in Phase 4
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 mEFs (Mouse embryonic fibroblasts)
Response regulation GW501516-activated PPARD stabilized peroxisomes through catalase upregulation by targeting peroxisomal hydrogen peroxide-mediated lysosomal rupture, which led to ferroptosis of xCT-deficient MEFs.
Health [ICD-11: N.A.]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Peroxisome proliferator-activated receptor delta (PPARD) Protein coding
 Regulator Info 
Responsed Drug GW501516 Discontinued in Phase 4
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 mEFs (Mouse embryonic fibroblasts)
Response regulation GW501516-activated PPARD stabilized peroxisomes through catalase upregulation by targeting peroxisomal hydrogen peroxide-mediated lysosomal rupture, which led to ferroptosis of xCT-deficient MEFs.
GW501516 [Discontinued in Phase 4]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Suppressor
Response Target Unspecific Target
Responsed Disease Health ICD-11: N.A.
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 mEFs (Mouse embryonic fibroblasts)
Response regulation GW501516-activated PPARD stabilized peroxisomes through catalase upregulation by targeting peroxisomal hydrogen peroxide-mediated lysosomal rupture, which led to ferroptosis of xCT-deficient MEFs.
References
Ref 1 Peroxisome proliferator-activated receptor rescues xCT-deficient cells from ferroptosis by targeting peroxisomes. Biomed Pharmacother. 2021 Nov;143:112223. doi: 10.1016/j.biopha.2021.112223. Epub 2021 Sep 25.