Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10191)
Regulator Name Glucose-6-phosphate 1-dehydrogenase X (G6pdx)
Synonyms
G6pd, G6pd-1
    Click to Show/Hide
Gene Name G6pdx
Gene ID 14381
Regulator Type Protein coding
Uniprot ID Q00612
Sequence
MAEQVALSRTQVCGILREELYQGDAFHQADTHIFIIMGASGDLAKKKIYPTIWWLFRDGL
LPEDTFIVGYARSRLTVDDIRKQSEPFFKATPEERPKLEEFFARNSYVAGQYDDAASYKH
LNSHMNALHQGMQANRLFYLALPPTVYEAVTKNIQETCMSQTGWNRIIVEKPFGRDLQSS
NQLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEP
FGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPATTGSDDVRDEKVKVLKCISEVET
DNVVLGQYVGNPNGEGEAANGYLDDPTVPHGSTTATFAAAVLYVENERWDGVPFILRCGK
ALNERKAEVRLQFRDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHKIDREKPQPI
PYVYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL

    Click to Show/Hide
Family Glucose-6-phosphate dehydrogenase family
Function
Catalyzes the rate-limiting step of the oxidative pentose- phosphate pathway, which represents a route for the dissimilation of carbohydrates besides glycolysis. The main function of this enzyme is to provide reducing power (NADPH) and pentose phosphates for fatty acid and nucleic acid synthesis.

    Click to Show/Hide
KEGG ID mmu:14381
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
G6pdx can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Fibrosarcoma ICD-11: 2B53
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 mEFs (Mouse embryonic fibroblasts)
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Response regulation Among the screen hits, many reported ferroptosis genes were identified, such as pentose phosphate pathway (PPP) gene G6PDX. Ferroptosis is an autophagic cell death process, and NCOA4-mediated ferritinophagy supports ferroptosis by controlling cellular iron homeostasis in fibrosarcoma HT1080 cells.
Fibrosarcoma [ICD-11: 2B53]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Glucose-6-phosphate 1-dehydrogenase X (G6pdx) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Autophagy hsa04140
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 mEFs (Mouse embryonic fibroblasts)
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Response regulation Among the screen hits, many reported ferroptosis genes were identified, such as pentose phosphate pathway (PPP) gene G6PDX. Ferroptosis is an autophagic cell death process, and NCOA4-mediated ferritinophagy supports ferroptosis by controlling cellular iron homeostasis in fibrosarcoma HT1080 cells.
References
Ref 1 Ferroptosis is an autophagic cell death process. Cell Res. 2016 Sep;26(9):1021-32. doi: 10.1038/cr.2016.95. Epub 2016 Aug 12.