Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10183)
Regulator Name DDB1- and CUL4-associated factor 7 (DCAF7)
Synonyms
HAN11, WDR68; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog
    Click to Show/Hide
Gene Name DCAF7
Gene ID 10238
Regulator Type Protein coding
Uniprot ID P61962
Sequence
MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFI
CRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFC
APLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDI
AFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATM
AMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMP
RAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

    Click to Show/Hide
Family WD repeat DCAF7 family
Function
Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.

    Click to Show/Hide
HGNC ID
HGNC:30915
KEGG ID hsa:10238
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
DCAF7 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Diabetes mellitus ICD-11: 5A10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Response regulation Diabetic peripheral neuropathy (DPN) is a serious complication in Diabetes Mellitus (DM) patients. Key modules constructed by the protein-protein interaction network analysis led to the confirmation of the following genes of interest: DCAF7, GABARAPL1, ACSL4, SESN2 and RB1.
Diabetes mellitus [ICD-11: 5A10]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator DDB1- and CUL4-associated factor 7 (DCAF7) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Response regulation Diabetic peripheral neuropathy (DPN) is a serious complication in Diabetes Mellitus (DM) patients. Key modules constructed by the protein-protein interaction network analysis led to the confirmation of the following genes of interest: DCAF7, GABARAPL1, ACSL4, SESN2 and RB1.
References
Ref 1 Bioinformatics analysis identifies potential ferroptosis key genes in the pathogenesis of diabetic peripheral neuropathy. Front Endocrinol (Lausanne). 2023 May 12;14:1048856. doi: 10.3389/fendo.2023.1048856. eCollection 2023.