Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10181)
Regulator Name Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2)
Synonyms
FLC3A, GEF2; GABA(A) receptor-associated protein-like 2; Ganglioside expression factor 2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; MAP1 light chain 3-related protein
    Click to Show/Hide
Gene Name GABARAPL2
Gene ID 11345
Regulator Type Protein coding
Uniprot ID P60520
Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

    Click to Show/Hide
Family ATG8 family
Function
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

    Click to Show/Hide
HGNC ID
HGNC:13291
KEGG ID hsa:11345
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
GABARAPL2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Sepsis ICD-11: 1G40
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vivo Model
Beijing Vital River Laboratory Animal Technology Co. Ltd. provided 20 specific pathogen-free female C57BL/6J mice (8-10 weeks old, weighing 20-22g). All procedures on mice were performed under sodium pentobarbital anesthesia, and all efforts were made to minimize suffering. 12 h after surgery, the blood was collected from orbital sinus.

    Click to Show/Hide
Response regulation 3 FRDEGs (TLR4, WIPI1, and GABARAPL2), with high sensitivity and specificity in sepsis diagnosis, were selected for construction of prognostic risk signature. The expression of genes in risk signature was also validated in CLP mouse model via qRT-PCR.
Sepsis [ICD-11: 1G40]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vivo Model
Beijing Vital River Laboratory Animal Technology Co. Ltd. provided 20 specific pathogen-free female C57BL/6J mice (8-10 weeks old, weighing 20-22g). All procedures on mice were performed under sodium pentobarbital anesthesia, and all efforts were made to minimize suffering. 12 h after surgery, the blood was collected from orbital sinus.

    Click to Show/Hide
Response regulation 3 FRDEGs (TLR4, WIPI1, and GABARAPL2), with high sensitivity and specificity in sepsis diagnosis, were selected for construction of prognostic risk signature. The expression of genes in risk signature was also validated in CLP mouse model via qRT-PCR.
References
Ref 1 Identification of a Ferroptosis-Related Prognostic Signature in Sepsis via Bioinformatics Analyses and Experiment Validation. Biomed Res Int. 2022 May 25;2022:8178782. doi: 10.1155/2022/8178782. eCollection 2022.