Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10156)
Regulator Name Leukemia inhibitory factor receptor (LIFR)
Synonyms
CD_antigen=CD118
    Click to Show/Hide
Gene Name LIFR
Gene ID 3977
Regulator Type Protein coding
Uniprot ID P42702
Sequence
MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNL
QVWNCSWKAPSGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKE
SMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDNLHFSGLEEWSDWSP
VKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSALIGHTNCPLIHLDGENVAIK
IRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEIICSWNPGRVTA
LVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQR
NVTIKGVENSSYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVIK
WCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFFLYGCRNQGYQLLRSMIGYIE
ELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEE
DLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND

    Click to Show/Hide
Family Type I cytokine receptor family
Function
Signal-transducing molecule. May have a common pathway with IL6ST. The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.

    Click to Show/Hide
HGNC ID
HGNC:6597
KEGG ID hsa:3977
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
LIFR can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HEK-293T cells Normal Homo sapiens CVCL_0063
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Mahlavu cells Hepatoma Homo sapiens CVCL_0405
PLC/PRF/5 cells Hepatocellular carcinoma Homo sapiens CVCL_0485
HA22T/VGH cells Hepatocellular carcinoma Homo sapiens CVCL_7046
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
In Vivo Model
PDX tumors in cold Dulbeccos Modified Eagles Medium (DMEM) were minced into 1-2 mm3 fragments, and each fragment was subcutaneously transplanted into the dorsal flank of 6-week-old male NSG (non-obese diabetic; severe combined immunodeficiency; interleukin-2 receptor gamma chain null) mice. Tumor growth was monitored by bidimensional tumor measurements with a caliper twice a week until the endpoint.

    Click to Show/Hide
Response regulation LIFR and SHP1 (PTPN6) positively regulate ferroptosis while LCN2 negatively regulates ferroptosis. Notably, an LCN2-neutralizing antibody enhances the ferroptosis-inducing and anticancer effects of sorafenib on hepatocellular carcinoma patient-derived xenograft tumors with low LIFR expression and high LCN2 expression.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Leukemia inhibitory factor receptor (LIFR) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HEK-293T cells Normal Homo sapiens CVCL_0063
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
Mahlavu cells Hepatoma Homo sapiens CVCL_0405
PLC/PRF/5 cells Hepatocellular carcinoma Homo sapiens CVCL_0485
HA22T/VGH cells Hepatocellular carcinoma Homo sapiens CVCL_7046
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
In Vivo Model
PDX tumors in cold Dulbeccos Modified Eagles Medium (DMEM) were minced into 1-2 mm3 fragments, and each fragment was subcutaneously transplanted into the dorsal flank of 6-week-old male NSG (non-obese diabetic; severe combined immunodeficiency; interleukin-2 receptor gamma chain null) mice. Tumor growth was monitored by bidimensional tumor measurements with a caliper twice a week until the endpoint.

    Click to Show/Hide
Response regulation LIFR and SHP1 (PTPN6) positively regulate ferroptosis while LCN2 negatively regulates ferroptosis. Notably, an LCN2-neutralizing antibody enhances the ferroptosis-inducing and anticancer effects of sorafenib on hepatocellular carcinoma patient-derived xenograft tumors with low LIFR expression and high LCN2 expression.
References
Ref 1 A targetable LIFR-NF-B-LCN2 axis controls liver tumorigenesis and vulnerability to ferroptosis. Nat Commun. 2021 Dec 17;12(1):7333. doi: 10.1038/s41467-021-27452-9.